DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG4830

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_650160.1 Gene:CG4830 FlyBaseID:FBgn0037996 Length:534 Species:Drosophila melanogaster

Alignment Length:532 Identity:115/533 (22%)
Similarity:185/533 (35%) Gaps:129/533 (24%)


Human   113 EEDEVQPNGKIFKKVILGQYNW--------------LSYEDVFVRAFNFGNGLQMLGQKPKTNIA 163
            :.:..:|...:.:.:.....||              :::......|......|:..|...|..|.
  Fly    20 QNNPFKPETSLGRIIFKNMRNWPKNVCQISDSEGVEVTFGQALTWAIRIAQQLKSRGLDHKDIIG 84

Human   164 IFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLV 228
            |........|..|.|||.:.....:....|....:.|..|.::...|.|..:..........:..
  Fly    85 ISARNTTYIMPTAVACFFHGTPFQSANPILEESTLKHLYNISKPKIIFTDADHYDKLYSATSAFK 149

Human   229 PRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPL---PSDIAVIMYTSGS 290
            |.:  |:|...|        .|::     :::.|.|....|......||   ||....|:.:||:
  Fly   150 PEI--ILTTGTK--------DGVL-----SIQDLLAPTKTEFFYQPTPLKEGPSQTVAILTSSGT 199

Human   291 TGLPKGVMISHSNIIAGITGMAERIPELGEEDVYI-GY------LPLAHVLELSAELVCLSHGCR 348
            ||:||.|.||:.              .|.:|.|:: ||      ..|..:..|.|.:....:||.
  Fly   200 TGMPKAVCISND--------------ILTQETVFVNGYDTIFISASLDWITGLWATIFSTVNGCT 250

Human   349 IGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPE----IMDRIYKNVMNKVSEMSSFQRNLF 409
            ...||....||....:       .|....|.....||    ::|                     
  Fly   251 RIISSKPFAADYFVYL-------VSKYSITYALIPPEHCCSLLD--------------------- 287

Human   410 ILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQG 474
                               |.:....|    ||...:|...||....||.:|...:.....:...
  Fly   288 -------------------CPTATPEK----LGSLTKLNFGGGRMTQATVERVKKLAPNGVLNSS 329

Human   475 YGLTESAGAGTISEVWDYNTGRV-----GAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQS 534
            ||:||   .|.|.    :|.|.:     |.||...::|:.: ::|.....::   .|||::....
  Fly   330 YGMTE---VGFIV----FNHGHLKLTAAGNPLPGIQVKIVD-DDGNQLGVNQ---TGEIIVHNGF 383

Human   535 VTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEA 599
            ...||:.:...|||  .:||.|  |..|||:|.|:.|..|.:.||||:::|.: |..:...:|||
  Fly   384 SWNGYFADPEATKA--MQDEEG--WFHTGDMGYFDEDDYLYMTDRKKEVLKWK-GLQMWPAEVEA 443

Human   600 ALKNLPLVDNIC 611
            .:..||.|..:|
  Fly   444 VIDELPEVKRVC 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 115/533 (22%)
CG4830NP_650160.1 CaiC 18..529 CDD:223395 115/533 (22%)
AFD_class_I 46..518 CDD:302604 112/507 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595274
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.