DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG3961

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_649067.2 Gene:CG3961 FlyBaseID:FBgn0036821 Length:704 Species:Drosophila melanogaster

Alignment Length:729 Identity:231/730 (32%)
Similarity:363/730 (50%) Gaps:93/730 (13%)


Human    25 FIHFL------ISLYTILTYIPFYFFSESRQEK-----SNRIKAKPVNSKPDSAYRS---VNSLD 75
            ::::|      ::|.::...:.:||.:....|:     .|:   .|:...|:..:.|   ..|.:
  Fly    29 YLYYLGGTLGTLTLGSLAASVAYYFATRPVPERPLVPLENQ---SPLLEGPEQIHVSKFYKESKN 90

Human    76 G-LASVLYPGCDTLDKVF---TYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLS 136
            | ..|.:.....||.:.|   .||.|   |...||.||.|.                 ..|.|::
  Fly    91 GKFVSYITENVRTLYQTFREGAYASN---NGPCLGWRETLT-----------------SPYQWIN 135

Human   137 YEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHA 201
            |::..:||.|||.|:..||.:||..|.|:.:.|.||::..|.|:.::..:|.||.|||..|....
  Fly   136 YDEALLRAKNFGAGMLALGARPKQLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFI 200

Human   202 LNETEVTNIITSKE-----LLQ---TKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAA 258
            :.:|::..:|...:     ||:   ..||.||::.| :|.......:       .:||.:.:...
  Fly   201 IRQTDMQVVIVEDDGKAAMLLEKAPRSLKIIVAIKP-IRQTTLERAR-------SRGIQIFSFID 257

Human   259 VEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEE-- 321
            ||.||||.   |.|...|...|:..:.||||:||.|||||::|.|::||:..:   |.::|:.  
  Fly   258 VEKLGAKG---NHPEVPPTAEDLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSV---ILQMGDHRI 316

Human   322 ---DVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAV 383
               ||.:.:|||||:.|...|......|..:|:        .|..||: ...|..|||||:|.||
  Fly   317 RAGDVMVSFLPLAHMFERCCENGMYYVGGCVGF--------YSGDIKE-LTNDLKMLKPTVMPAV 372

Human   384 PEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKG--RNTPLCDSFVFRKVRSLLGGNIR 446
            |.:::|:|..:.|.:| .|..:|.||.:|...|.::|::|  |.....|..||:||....|||:|
  Fly   373 PRLLNRVYDKIQNDIS-ASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLR 436

Human   447 LLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNW 511
            |::.|.|||:.....||.....|.|.:|||.||..||.|::...|:....||.|:.|..:||.:.
  Fly   437 LMVVGSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDV 501

Human   512 EEGGYF---NTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGC 573
            .|..||   ||      ||:.:.|.:|..||||:..|| |:..:.|.   |..|||:|.:.|:|.
  Fly   502 PEMEYFANQNT------GEVCVRGSNVFHGYYKDPEKT-AEAIDSEG---WHHTGDVGMWLPNGT 556

Human   574 LKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARK 638
            |:||||:|.:.||..|||:...|:|........|:.:..|..|..|.:|..|||:...|.:.|.:
  Fly   557 LRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATE 621

Human   639 KGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRK 703
            ..::||...|||:..::..::..:......:.|:.||....|.|.|:|::.:.||:|..||.||.
  Fly   622 NNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRP 686

Human   704 ELKTHYQADIERMY 717
            :||::::..:|.||
  Fly   687 QLKSYFKPQLEDMY 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 229/717 (32%)
CG3961NP_649067.2 PLN02736 101..703 CDD:178337 219/655 (33%)
LC-FACS_euk 129..700 CDD:213293 206/605 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1022
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126601
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.