DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG18586

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:558 Identity:120/559 (21%)
Similarity:196/559 (35%) Gaps:156/559 (28%)


Human   120 NGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNF 184
            |.|:..::.:.:...|:.||:.:.|....:.::.:|......:.:...........|.|||....
  Fly    50 NPKLIAQISITEDIVLTREDLHMNAMRVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGT 114

Human   185 QLVTLYATLGGPAIVHALNETEVTNII---TSKELLQTKLKDI-VSLVP---------RLRHIIT 236
            .|..|:.......|......|:...|.   ...|.:::..||: |::|.         |::.::|
  Fly   115 PLHALHNAYEEACIAKLFGITKPRLIFCDGDEYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLT 179

Human   237 VDGKPPTWSEFP----KGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGV 297
            .    |....|.    |..|.||:|                          |:.:||::|.||.|
  Fly   180 T----PVMQNFQPLRLKDGIDHTLA--------------------------ILSSSGTSGFPKAV 214

Human   298 MISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTL---AD 359
            .||:|:                  .:.:.|:.:              :...|.|:| .||   :.
  Fly   215 TISNSH------------------KIIVDYMAI--------------NNSNIQYTS-STLDWCSG 246

Human   360 QSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILA---YNYKMEQIS 421
            .|..|..|....||::..                        ..|...||..|   |...|..:|
  Fly   247 LSMAITSGVFSTTSIIAD------------------------CDFDPGLFCRAIGKYRISMVLLS 287

Human   422 KG-----RNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQR---------FMNICFCCPVG 472
            ..     .|   |..|....:.||     ..::.||:..|...||         .:|.|      
  Fly   288 SSYLAIFAN---CPEFESADLSSL-----NYVIFGGSSCSLEVQRKVRSRLSHDCLNFC------ 338

Human   473 QGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTM 537
              |||||...||:::..:|.....||..:  ..||:|..:|.|  ...:|:..|||.........
  Fly   339 --YGLTELNSAGSVNLNFDEKPNSVGRAI--RGIKIKVIDEQG--EAQEPNVVGEICFHNSQKWA 397

Human   538 GYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALK 602
            |||||..:|:    :.::.:.|:.|||:|..:.||.|.:|||.||::|.|...|.. .::|..:.
  Fly   398 GYYKNPDETR----QIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYP-SEIENVIA 457

Human   603 NLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKG 640
            .:|.|...|.:.       |...|...:....|.:|.|
  Fly   458 EMPNVLEACVFG-------IWDPVNGDEAAASLVKKPG 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 120/559 (21%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 120/559 (21%)
AFD_class_I 55..530 CDD:302604 118/554 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.