DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG5568

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_647992.1 Gene:CG5568 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster

Alignment Length:566 Identity:134/567 (24%)
Similarity:212/567 (37%) Gaps:150/567 (26%)


Human   116 EVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACF 180
            :::.|..:..::.:.:...|:::|:...|....:.::.||.:....:.:...........|.|||
  Fly    46 QMERNAMLTAQISVTENTELTWKDIQTNAMKVASYMRKLGLEQGDFVGVIGRLTTHLTALAYACF 110

Human   181 MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLV-PRLRHIITVDGKPPTW 244
             :|          |.|  .|||:          .|..|:.::.:..:. |||   |..||     
  Fly   111 -FN----------GTP--YHALH----------TEYEQSAIERLFGITKPRL---IFCDG----- 144

Human   245 SEFPKGIIVHTMAAVEALGAK-ASMENQP----------------HSKPL-----PSDIAVIMYT 287
            .||.|     ..||.:.|..: .:|.|.|                :.:|:     ...:..|:.:
  Fly   145 DEFEK-----VQAATKGLQVQIVTMRNHPAGILRIQDILTTPVEMNFRPVRLKDGTDQLLAILSS 204

Human   288 SGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYS 352
            ||::||||.|.||:|:.|.|                  .:||:...:              |.| 
  Fly   205 SGTSGLPKAVTISNSHQIIG------------------SFLPVDSSI--------------IQY- 236

Human   353 SPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQ-RNL--FILAYN 414
            :|.|| |.:|.|..           |:.|||..         :..:.|...|. .||  .|..|.
  Fly   237 NPNTL-DWASGITM-----------TINAAVFS---------LTSIIEDCDFDPANLCGLIEKYR 280

Human   415 YKMEQISKGRNTPL--CDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQ-----RFMNICFCCPVG 472
            ..|..:|..:...|  |..|....:.|     ::....||:..|...|     |..|.|    |.
  Fly   281 ISMVFVSSSQLAMLSNCPEFYAADLSS-----VKYFFYGGSNCSLEVQNKIRSRLSNEC----VN 336

Human   473 QGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTM 537
            ..|.|||....|.::..:|.....||.|:...:||:.| |.|   ....|:..|||.........
  Fly   337 FSYTLTELNSPGCLNFNFDEKPNSVGRPVRGIQIKIVN-ELG---EAQGPNVVGEICFNNGQKWP 397

Human   538 GYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALK 602
            |||||..:||    :.::.:.|..|||:|..:.||.|.||||.||::|.|...|.. .::|:.:.
  Fly   398 GYYKNPEETK----KMQDSENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYP-SEIESVIA 457

Human   603 NLPLVDNICAYA---NSYHSYVIGFVVPNQ------KELTELARKK 639
            .:|.|...|.:.   ..|.......||..|      :::.|..||:
  Fly   458 EMPNVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVRKR 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 134/567 (24%)
CG5568NP_647992.1 CaiC 35..540 CDD:223395 134/567 (24%)
Firefly_Luc_like 55..530 CDD:213279 133/558 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595201
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.