DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG4563

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_611913.1 Gene:CG4563 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster

Alignment Length:516 Identity:115/517 (22%)
Similarity:198/517 (38%) Gaps:132/517 (26%)


Human   155 GQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYAT--LGGPAIVHALNETEVTNIITSKELL 217
            |...:..:.|...:....:..|.|||   ||....:|.  ...||||..|.......|:......
  Fly    79 GLTQEDRVGIIANSSTFVIPVATACF---FQATPFHAVNYSREPAIVQGLYSVTKPKIMFIDGPD 140

Human   218 QTKLKDIV-SLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD- 280
            ..::|:|. ...|:|   ||:.||            |..:.::|.|           .||.|:: 
  Fly   141 YDRIKEITKEWSPKL---ITLTGK------------VEGVTSIEDL-----------VKPHPAEK 179

Human   281 -------------IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAH 332
                         |||::.:||:.||||.|.:||.:|                            
  Fly   180 IYVPASLATGGDQIAVVLCSSGTAGLPKAVALSHRHI---------------------------- 216

Human   333 VLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSML-KPTLMAAVPEIMDRIYKNVMN 396
               .|...:|:|.......::...:...|..:...:.|.|.:: :.|..|.....:...||....
  Fly   217 ---ASTNSLCISTDVLYTSATIDWMTGFSITVMNLTCGFTRIISRRTFSAETALYLVSKYKVTCL 278

Human   397 KVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAP--LSATT 459
            .::...:::.....||.:.::|.:               |:..::||.|.|.|...|.  |..|.
  Fly   279 AMAPWQAYELFTSPLATSEQLESL---------------KIAFVIGGWISLALLRRAQELLPKTY 328

Human   460 QRFMNICFCCPVGQGYGLTESAGAGTIS--EVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKP 522
            ..|           .||.||: |..||:  ...:.:.||: ||.:..:|:.::.::.|...|   
  Fly   329 VMF-----------SYGTTET-GVVTINIDHSLECSVGRL-APGMRIKIQGEDGQQLGVNQT--- 377

Human   523 HPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQ 587
               ||:||.......||..|...| |...:|    .|:..||:|.|:.|..|.::||||||:|.:
  Fly   378 ---GEVLIDIGLKWEGYLSNPEDT-ATTLQD----GWINLGDLGYFDEDNNLYLVDRKKDLLKYK 434

Human   588 AGEYVSLGKVEAALKNLPLVDNICA-------YANSYHSYVI---GFVVPNQKELTELARK 638
            :..|.. .::|..:..||.|:::|.       |.::..:.:|   |..:.:||.:..:|::
  Fly   435 SKHYWP-NEIEQIIAELPEVEHVCVVGVRDARYGDAAGALIIKKEGAEIADQKVIDHVAQR 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 115/517 (22%)
CG4563NP_611913.1 CaiC 21..531 CDD:223395 115/517 (22%)
Firefly_Luc_like 49..521 CDD:213279 115/517 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595290
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.