DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and Fatp3

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_726437.2 Gene:Fatp3 FlyBaseID:FBgn0034999 Length:687 Species:Drosophila melanogaster

Alignment Length:596 Identity:130/597 (22%)
Similarity:217/597 (36%) Gaps:167/597 (28%)


Human   162 IAIFCETRAE----WMIAAQACFMYNFQLVT--LYATLGGPAIVHALNETEVTNIITSKELLQT- 219
            :|:..|||.|    |:..:|      ..::|  :.:.|.|.:::|::.......:|...|||.. 
  Fly   166 VALLMETRLEYPCIWLGLSQ------LGVITALINSNLRGESLLHSIKVANAKALIVGSELLDVL 224

Human   220 ---KLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMA-----AVEALGAKASMENQPHSKP 276
               :.|:.:..||..::.          .:..:|:..|.:.     .|.||..:..:|       
  Fly   225 VSLREKEQLDEVPIYQYT----------DDEVRGVAGHDLLPGAVDLVTALKTQKKLE------- 272

Human   277 LPSDIA--------VIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHV 333
            |||.:.        :.:||||:|||||..:|::...:....|....: ::..:||....|||.| 
  Fly   273 LPSAVCPGEARSKLLYVYTSGTTGLPKAAVITNLRFLFMSAGSYYML-KMSSDDVVYDPLPLYH- 335

Human   334 LELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEI-MDRIYKNVMNK 397
                      :.|..:|.         .:.|..||   |.:|:....|....: .||....|...
  Fly   336 ----------TAGGIVGV---------GNAILNGS---TVVLRKKFSARNFWLDCDRHNCTVAQY 378

Human   398 VSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRF 462
            :.|:..     ::||.:|..:|...                     |:||:...|......:|..
  Fly   379 IGELCR-----YLLATSYSPDQQKH---------------------NLRLMYGNGLRPQIWSQFV 417

Human   463 MNICFCCP-VGQGYGLTESAGAGTISEVWDYNTGRVGA---------------PLVCCEIK---L 508
            ..  |..| :|:.||.||  |...:..:    |.||||               .|.|.|..   |
  Fly   418 RR--FGIPHIGEIYGATE--GNSNLINI----TNRVGAIGFVPVYGSSLYPVQVLRCDEYTGELL 474

Human   509 KNWEEGGYFNTDKPHPRGEILIG------GQSVTMGYY---KNEAKTKADFFEDENGQRWLCTGD 564
            |  :..|:....:|...| :|:|      ..|...||.   .:|.|...:.|  .:|..:..:||
  Fly   475 K--DSKGHCIRCQPGQAG-LLVGKVDARRAVSAFHGYADKGASEQKLLRNVF--TSGDVFFNSGD 534

Human   565 IGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQ 629
            :...:..|.....||..|..:.: ||.|:..:|||.:.|...:::...|         |..:|: 
  Fly   535 MVVRDILGYFYFKDRTGDTFRWR-GENVATQEVEAIITNCVGLEDCVVY---------GVQIPH- 588

Human   630 KELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLV 694
                 :..|.|:...       .:.|.:|........:..||..:..|:.|||..|  .|.|.  
  Fly   589 -----VEGKAGMAAI-------VDPERKVDMDYLSVVLRGSLPPYARPLFIRLLDE--IPRTA-- 637

Human   695 TDAFKLKRKEL 705
              .||||::||
  Fly   638 --TFKLKKREL 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 130/597 (22%)
Fatp3NP_726437.2 PRK08279 90..684 CDD:236217 130/597 (22%)
hsFATP4_like 136..653 CDD:213305 130/597 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91628236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.