DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and Fatp2

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_995925.2 Gene:Fatp2 FlyBaseID:FBgn0265187 Length:714 Species:Drosophila melanogaster

Alignment Length:687 Identity:158/688 (23%)
Similarity:256/688 (37%) Gaps:178/688 (26%)


Human    77 LASVLYPGCDTLDKVFTYAK----NKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSY 137
            :|:|..|. ||: .:|.|.:    .|.:.::.|...::.......||:    |..|:.:....::
  Fly   109 IAAVTTPR-DTV-ALFAYIRVLLFIKRQERKNLNIGDIFESNVARQPD----KLAIVSESQQWTF 167

Human   138 EDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVT--LYATLGGPAIVH 200
            ..|...:....|.....|.|....:.:..|.|||::  |....:....::|  :...|.|.::.|
  Fly   168 RQVNEHSNRVANVFHSHGYKKGDVVGLLLENRAEFV--ATWLGLSKIGVITPLINTNLRGASLQH 230

Human   201 ALNETEVTNIITSKELLQTKLKDIVSLVP-----------RLRHIITVDGKPPTWSEFPKGIIVH 254
            ::...:.|.:|.... .::.:.||...:|           ..:.::..:|.....::...|::  
  Fly   231 SITVGQCTALIYGAS-FRSAVMDIAKDLPAHVGLYQFNDESNQEVVASEGLSQGLAQQLNGLL-- 292

Human   255 TMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSN---IIAGITGMAERIP 316
            ..||.:.:.|.||..:. |.|      .|.:||||:|||||..:|:||.   |.|||.      .
  Fly   293 ETAAKDKVAAGASRADH-HDK------LVYIYTSGTTGLPKAAVITHSRYFFIAAGIH------Y 344

Human   317 ELG--EEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTL 379
            .||  ::||:...|||.|    :|..| :|.|..:.:.|...:..:.|  ..|...|.:..:.| 
  Fly   345 TLGFKDQDVFYTPLPLYH----TAGGV-MSMGQALLFGSTVVIRKKFS--ASGYFSDCARFQCT- 401

Human   380 MAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGN 444
                          |...:.||:.     :|||             ||........:||.:.|..
  Fly   402 --------------VGQYIGEMAR-----YILA-------------TPSAPHDRNHQVRMVFGNG 434

Human   445 IRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTE----------SAGA-GTISEVW-------- 490
            :|         .....:|:.......||:.||.||          :.|| |.||.:.        
  Fly   435 LR---------PQIWPQFVERFGIRKVGEFYGATEGNANIMNNDSTVGAIGFISRILPQIYPISI 490

Human   491 ---DYNTGRVGAPL-----VC--CEIKLKNWEEGGYFNTDKPHPRGEILIGGQ-SVTMGYYKNEA 544
               |.:||.   ||     :|  ||.     :|.|.|       .|:|:.|.. ...:||...:|
  Fly   491 IKADPHTGE---PLRNSQGLCERCEA-----DEPGVF-------VGKIVRGNPCREFLGYVDQKA 540

Human   545 KTKA---DFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPL 606
            .:|.   |.|  ..|.....:||:...:..|.|...||..|..:.: ||.||..:|||.|.||..
  Fly   541 SSKKVVHDVF--SKGDMAFISGDLLVADERGYLYFKDRTGDTFRWK-GENVSTSEVEAQLSNLAG 602

Human   607 VDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEEL--CNSCEMENEVLKVLSEAAISA 669
            ..::..|         |..:||    ||  .:.|:...::..  .|..::..|:.|.|...|...
  Fly   603 YKDVIVY---------GVSIPN----TE--GRAGMAAIYDPTREVNVSQLGVELAKSLPNYARPQ 652

Human   670 SLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELK 706
            .|....   ||.|            |..|||::.||:
  Fly   653 FLRFLR---KIDL------------TGTFKLRKVELQ 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 158/688 (23%)
Fatp2NP_995925.2 PRK08279 115..714 CDD:236217 156/682 (23%)
AFD_class_I 163..680 CDD:302604 145/628 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92684877
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.