DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG9993

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster

Alignment Length:517 Identity:118/518 (23%)
Similarity:195/518 (38%) Gaps:174/518 (34%)


Human   157 KPKTNIAIFCE-TRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTK 220
            |||   .|||: ...:.:.|.::...:..:::.|..||.|           |.||   ::||   
  Fly   125 KPK---VIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPG-----------VRNI---QDLL--- 169

Human   221 LKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM 285
                            .||        ..|....|:.|.            ||.  ...|.|.|:
  Fly   170 ----------------ADG--------CTGYDEKTLFAC------------PHL--CGDDTAFII 196

Human   286 YTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEED-VYIGYLPLAHVLELSAELVCLSHGCRI 349
            .:||.|||||||..||.:::     .:.:||:|...| |...:.||..:..:...|..|.:|||.
  Fly   197 TSSGVTGLPKGVTRSHRSLL-----NSAKIPQLFTSDTVLFCFSPLYWISCIFTLLASLVNGCRR 256

Human   350 GYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYN 414
            ..::                      :|..:|...::::|      ::||.:.:...::.:||.:
  Fly   257 IITN----------------------RPFSVAYFADLVER------HQVSFVLTVPHHMALLAKS 293

Human   415 YKMEQIS-----------KGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFC 468
            .:.::::           .|...|:   .::|::..|||.|                ||..:   
  Fly   294 PERQELAAKMQCVQSFVCSGSKVPM---GIWRQLYELLGAN----------------RFAVL--- 336

Human   469 CPVGQGYGLTESAGAGTISEVWDYNTGRVGAPL-----VCCEIKLKNWEEGGYFNTDKPHPRGEI 528
                  |||||:.|   ||:       .||.||     :...::::..:..|  .:..|:..|:|
  Fly   337 ------YGLTETGG---ISK-------NVGGPLGSEGRLLRNVQVRVVDPHG--QSLGPNQTGQI 383

Human   529 LIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKL------- 586
            |:.......|||.|..:|:.....|   .:||.|||.|.|:.:|||....|..|:.|.       
  Fly   384 LVRLNLRWGGYYHNPQETQVTVTPD---GKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYP 445

Human   587 QAGEYVSL---GKVEAALKNLP--LVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKG 643
            :..|.|.|   |..|.|:..:|  :..|:.|.|          ||.|:.||.....:..:||
  Fly   446 KQIEDVILHLPGVHEVAVFGIPDEVSTNLTACA----------VVRNEDELGAQLTEADVKG 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 118/518 (23%)
CG9993NP_611518.1 CaiC 21..532 CDD:223395 118/518 (23%)
AFD_class_I 45..528 CDD:302604 118/518 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595304
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.