DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG17999

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster

Alignment Length:548 Identity:120/549 (22%)
Similarity:198/549 (36%) Gaps:152/549 (28%)


Human   119 PNGKIF--KKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFM 181
            |.||.|  .::.||        :|.:|.... |..|::.         .|:|..:.:..||.. .
  Fly    17 PRGKDFYGPEMTLG--------EVIMRVLQI-NADQVMQ---------ICDTTGQELTGAQLA-Q 62

Human   182 YNFQLVTLYATLG---GPAI-VHALNETEVTNIITS------------KELLQTKLKDIVSLV-P 229
            .:.::...:..||   |..: :.|.|.|.:|::|.:            .|..:..:|.:..:. |
  Fly    63 QSARIAQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEP 127

Human   230 RL-------RHII-TVDGK--PPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLP----SD 280
            ::       .||| ||:||  .|.......|.:...:...|.|..:.|:....: .|.|    ..
  Fly   128 KVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAY-VPCPKLHGDH 191

Human   281 IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEED-VYIGYLPLAHVLELSAELVCLS 344
            .|.|:.:||:||:||||..||.:::...     :.|.....| |.:.:.||..:......|..|.
  Fly   192 TAFIVCSSGTTGMPKGVTRSHRSLLCNC-----KNPNTYTRDSVLLSFSPLYWISGTIILLASLL 251

Human   345 HGC-RIGYSSP-------QTLADQ--------SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKN 393
            :|| ||..:.|       |.:|..        |.:|...||.|:                    :
  Fly   252 NGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDS--------------------D 296

Human   394 VMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSAT 458
            ||...:::.|.              ::..|..:.:|.: |.|::..|:|                
  Fly   297 VMELKAQLQSI--------------RVLIGAGSKVCKA-VCRRMYELIG---------------- 330

Human   459 TQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPH 523
            .|||:         .||||:|..|.          :..||.|:.|....::|.|.........|.
  Fly   331 NQRFV---------VGYGLSEMGGL----------SKNVGGPVGCEGKVMRNVELRVLDKLKMPL 376

Human   524 PRGEILIGGQSVTM---GYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVK 585
            ...|:.|....:..   |||:|...|:.....|   ..|..|||||..:.:|.|.|..|..|:.|
  Fly   377 GINEVGIIYARLRFKWAGYYRNPEATRRALSSD---GMWFRTGDIGYLDSEGYLYIQTRDTDVFK 438

Human   586 LQAGEYVSLGKVEAALKNLPLVDNICAY 613
            ....: :...::|..:..||.|...|.:
  Fly   439 FNNFQ-IYPEQIEEFILRLPGVSEACVF 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 120/549 (22%)
CG17999NP_611517.1 CaiC 25..545 CDD:223395 116/541 (21%)
AFD_class_I 38..529 CDD:302604 112/520 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595321
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.