| Sequence 1: | NP_001341087.1 | Gene: | ACSL3 / 2181 | HGNCID: | 3570 | Length: | 720 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611517.1 | Gene: | CG17999 / 37357 | FlyBaseID: | FBgn0034552 | Length: | 545 | Species: | Drosophila melanogaster | 
| Alignment Length: | 548 | Identity: | 120/548 - (21%) | 
|---|---|---|---|
| Similarity: | 198/548 - (36%) | Gaps: | 152/548 - (27%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human   119 PNGKIF--KKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFM 181 
Human   182 YNFQLVTLYATLG---GPAI-VHALNETEVTNIITS------------KELLQTKLKDIVSLV-P 229 
Human   230 RL-------RHII-TVDGK--PPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLP----SD 280 
Human   281 IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEED-VYIGYLPLAHVLELSAELVCLS 344 
Human   345 HGC-RIGYSSP-------QTLADQ--------SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKN 393 
Human   394 VMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSAT 458 
Human   459 TQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPH 523 
Human   524 PRGEILIGGQSVTM---GYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVK 585 
Human   586 LQAGEYVSLGKVEAALKNLPLVDNICAY 613 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ACSL3 | NP_001341087.1 | AFD_class_I | 30..717 | CDD:418409 | 120/548 (22%) | 
| CG17999 | NP_611517.1 | CaiC | 25..545 | CDD:223395 | 116/540 (21%) | 
| AFD_class_I | 38..529 | CDD:302604 | 112/519 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165149095 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||