DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG8834

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_610779.1 Gene:CG8834 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster

Alignment Length:578 Identity:130/579 (22%)
Similarity:207/579 (36%) Gaps:127/579 (22%)


Human   112 NEEDEVQPNGK----------IFKKVILGQYNW--------------LSYEDVFVRAFNFGNGLQ 152
            ||:|.:....|          :.|.:.....||              :::|.....:......|:
  Fly     9 NEKDNIWSGAKRNSIYNYDTSVGKIIFNNMKNWPKNVCQICDVDGVTVTFEQGLTWSIRIAQYLK 73

Human   153 MLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELL 217
            ..|...|..|.|..:.....|....||.|......::...|....:.|..:.|:.|.|....:..
  Fly    74 KRGLNHKDVIGIAAKNSTYVMPLGVACLMNGTPFHSVNPVLDDATLTHVFSITKPTLIFCDGQEY 138

Human   218 QTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMEN--QPHSKPLPSD 280
            ....|..|...|.:.          |.::..:|:     ..:|.|....:.|.  ||.......|
  Fly   139 DKVHKATVGWHPEIL----------TLTDHVEGV-----QGIETLLDPTTTEKIYQPEVLKEGGD 188

Human   281 IAV-IMYTSGSTGLPKGVMISHSNIIAG---ITGMAERIPELGEEDVYIGYLPLAHVLELSAELV 341
            ..| |:.:||:|||||.|.||:|.:|..   ||         .:..:|:|.. |..:..|.|.:.
  Fly   189 QTVAILCSSGTTGLPKAVCISNSILIQDSMLIT---------SQSVIYVGSC-LDWITGLWAFVF 243

Human   342 CLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQR 406
            ....||....|:.....:....:.|..|.:.::|.|..::|:....|.       |...::.   
  Fly   244 STVFGCTRIISNKAFTPEYFVGLVKKYKINYAVLPPRHLSALITCPDA-------KPDALAP--- 298

Human   407 NLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPV 471
               |...||.                         ||:|.|         ||.||...:|.....
  Fly   299 ---ITHLNYG-------------------------GGSISL---------ATLQRSQELCKTAMF 326

Human   472 GQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEG---GYFNTDKPHPRGEILIGGQ 533
            ..|||:|| .||.||: :...|....|.|:...:|::.: |:|   ||      :..|||.:...
  Fly   327 NSGYGMTE-VGAITIN-IGISNVSSAGRPVPGIKIRIVD-EDGKSLGY------NQVGEIYVHTG 382

Human   534 SVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVE 598
            ....|||.|..:|:.  .:|..|  |..|||:|.|:....|.|:||||:::|.....|... ::|
  Fly   383 QAWNGYYGNPVETRR--MQDFEG--WFHTGDLGYFDEQNFLYIVDRKKEILKYNGLHYWPT-EIE 442

Human   599 AALKNLPLVDNICAYA--NSYHSYVIGFVVPNQKELTELARK------KGLKGTWEEL 648
            ..:..|..|.::|...  :.......|.:|...|..|..|::      |.|..|.::|
  Fly   443 TVIAELSQVQDVCVVGIYDEREGDAAGALVVKSKGATISAKEIVEHVAKRLPATQKQL 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 130/579 (22%)
CG8834NP_610779.1 CaiC 20..529 CDD:223395 126/568 (22%)
AFD_class_I 46..519 CDD:302604 123/542 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595254
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.