DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and hll

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_609696.1 Gene:hll FlyBaseID:FBgn0286723 Length:681 Species:Drosophila melanogaster

Alignment Length:753 Identity:169/754 (22%)
Similarity:304/754 (40%) Gaps:175/754 (23%)


Human    63 KPDSAYRSVNSLDGL----------ASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEV 117
            ||.::|||.:..|.:          :..:.|  .|:.:.|..:..|:.:...|            
  Fly     5 KPATSYRSTSLHDAVKLRLDEPSSFSQTVPP--QTIPEFFKESCEKYSDLPAL------------ 55

Human   118 QPNGKIFKKVILGQYNW--LSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACF 180
                 :::....|...|  |::.:...|.......|..:|.:.::::.|......||..|.....
  Fly    56 -----VWETPGSGNDGWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGAL 115

Human   181 MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWS 245
            .....:..:|.:....|:.|.|...|.:..:........||:.|...:|||:.:|.:.|....:.
  Fly   116 RAGAVVAGVYPSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFV 180

Human   246 EFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDI------------AVIMYTSGSTGLPKGVM 298
            :...|..           :...::.|..|..|..::            |::::|||:.|:||.||
  Fly   181 DHEPGYF-----------SWQKLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVM 234

Human   299 ISHSNIIAGITGMAERIPEL--GEEDVYIGYLPLAHV-LELSAELVCLSH-GCRIGYSSPQTLAD 359
            :||.|::......|..:.::  |:|. ::.||||:|| .::....:.||| ||       .|.||
  Fly   235 LSHDNLVFDTKSAAAHMQDIQVGKES-FVSYLPLSHVAAQIFDVFLGLSHAGC-------VTFAD 291

Human   360 QSSKIKKGSKGDT-SMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQ---I 420
            :.:  .||:...| ...:||.|..||.:.:::.:.::...::...:.|.|...|.....|.   :
  Fly   292 KDA--LKGTLIKTFRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTL 354

Human   421 SKGRNTPLCDSF-------VFRKVRSLLG-GNIRLLLCGGAPLSATTQRF---MNICFCCPVGQG 474
            ..|::..:..:.       |.:.:|.::| .|.|:...||||.|...::|   ::|.    :|:.
  Fly   355 MAGKSPSIYGNAKYWLACRVVKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIA----LGEC 415

Human   475 YGLTESAGAGT----ISEVWDYNTGRVGAPLVCCE---IKLKNWEEGGYFNTDKPHPRGEILIGG 532
            ||::|::||.|    ||.:  |:.|:      .||   :|:...:..|         :||||:.|
  Fly   416 YGMSETSGAITLNVDISNL--YSAGQ------ACEGVTLKIHEPDCNG---------QGEILMRG 463

Human   533 QSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKV 597
            :.|.|||.....||:....||    .||.:||:|..:|.|.|.|..|.|:|:....||.:....:
  Fly   464 RLVFMGYLGLPDKTEETVKED----GWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHI 524

Human   598 EAAL-KNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKK------------GLKGTWEELC 649
            |..: |.||.|.|:         .:||   .::|.||.|...|            .|:....|..
  Fly   525 EELIKKELPCVSNV---------LLIG---DHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWL 577

Human   650 NSCEME----NEVLKVLSE-------AAISASLE-------------------KFEIP-----VK 679
            ...::.    :|:|.:.::       ||::|:||                   |:.|.     .|
  Fly   578 RDLDIHETRLSELLNIPADLQLPNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQK 642

Human   680 IRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMY 717
            ..|....::..||.:....|::|..:...|...|||:|
  Fly   643 FALIAHEFSVATGELGPTLKIRRNIVHAKYAKVIERLY 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 168/752 (22%)
hllNP_609696.1 FAA1 37..681 CDD:223953 162/720 (23%)
AFD_class_I 62..680 CDD:302604 157/676 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92863423
eggNOG 1 0.900 E1_COG1022
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.