DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and pdgy

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_001188590.1 Gene:pdgy FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster

Alignment Length:596 Identity:140/597 (23%)
Similarity:239/597 (40%) Gaps:168/597 (28%)


Human   156 QKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNIIT----SKEL 216
            |||.. :||......|:.|                ||||  ||...|..|.|..:.|    :::|
  Fly   126 QKPDV-LAICLPNLPEYPI----------------ATLG--AIEAGLTVTTVNPVYTPDEIARQL 171

Human   217 LQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGI-------IVHTMAAVEALGAKA-------S 267
            ..:..|.:|.         ||.|. .|.|:..|.:       :|.| :|.|||...|       |
  Fly   172 TFSGAKFLVG---------TVSGF-ATLSQASKLVGRQIPIAVVRT-SAEEALPEGAIDFSELTS 225

Human   268 MEN------QPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIP--ELGEEDVY 324
            .:|      :...:....|:..:.::||:||||||||:||:||.:....:...:|  .:|.::..
  Fly   226 TQNVRYEDLKAPKEASADDMVFLPFSSGTTGLPKGVMLSHNNITSNCEQVQASLPLDLMGPQNTL 290

Human   325 IGYLPLAHVLELSAELVC-LSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPE--- 385
            .|.||..|:..|:..::. |..|||:.                           |:....|:   
  Fly   291 PGVLPFFHIYGLTVVMLSKLGQGCRLA---------------------------TMPCFKPDDFM 328

Human   386 -IMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLL 449
             .:|:...:::|.|..::     ||::             |.|        |:......::::::
  Fly   329 RSLDKYQGSILNLVPPIA-----LFMI-------------NHP--------KLTQETAPHLKVVM 367

Human   450 CGGAPLSA-TTQRFMNICFCCPVGQGYGLTESAGAGTI----SEVWDYNTGRVGAPLVCCEIKLK 509
            .|.||:.. ..:||:|........||||:||::....:    ::|: .:||.:.|......:.|.
  Fly   368 SGAAPIGQHDVERFLNKFPNTVFKQGYGMTEASPVVLLTPEGNKVY-ASTGVLPASTEAKIVPLD 431

Human   510 NWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCL 574
            ..:..|.    .|...||:.:.|..|..||..|:...:..|:..    .||.:||:..::.||..
  Fly   432 GSDAKGV----GPRTTGELCVRGPQVMAGYLNNDEANQVTFYPG----NWLRSGDVAFYDEDGLF 488

Human   575 KIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQ------KELT 633
            .|.||.|:|:|:: |..|...::||.|::.|.:         ..:.|.|  :|::      :.:.
  Fly   489 YITDRMKELIKVK-GFQVPPAELEAVLRDHPKI---------LEAAVFG--IPHEFNGEAPRAIV 541

Human   634 ELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAF 698
            .|  ::|.|.:.||:  |..:...|          |..:|.|..| |.:...|..| ||      
  Fly   542 VL--RQGEKASAEEI--SAYVAERV----------AHYKKLEGGV-IFVDEVPKNP-TG------ 584

Human   699 KLKRKELKTHY 709
            |:.|:|||..:
  Fly   585 KILRRELKEKF 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 140/597 (23%)
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 140/595 (24%)
Firefly_Luc_like 99..587 CDD:213279 136/587 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91234183
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.