DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and Fatp1

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_001162940.3 Gene:Fatp1 FlyBaseID:FBgn0267828 Length:746 Species:Drosophila melanogaster

Alignment Length:657 Identity:155/658 (24%)
Similarity:256/658 (39%) Gaps:153/658 (23%)


Human    90 KVFTYAKNKFKNKRLLGT-REVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQM 153
            |:..|.|   :::||..| .:|.....:..|:    |..::.:....::..|...|....|.||.
  Fly   163 KLLRYTK---RHERLNYTVADVFERNVQAHPD----KVAVVSETQRWTFRQVNEHANKVANVLQA 220

Human   154 LGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVT--LYATLGGPAIVHALNETEVTNIITSKEL 216
            .|.|....:|:..|.|||::  |....:....::|  :...|.||:::|::.....:.:|..::.
  Fly   221 QGYKKGDVVALLLENRAEYV--ATWLGLSKIGVITPLINTNLRGPSLLHSITVAHCSALIYGEDF 283

Human   217 LQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDI 281
            |:. :.|:...:|....:...:.:... ||..|.|  .....:.||...||.|....::....|.
  Fly   284 LEA-VTDVAKDLPANLTLFQFNNENNN-SETEKNI--PQAKNLNALLTTASYEKPNKTQVNHHDK 344

Human   282 AVIMYTSGSTGLPKGVMISHSN---IIAGI---TGMAERIPELGEEDVYIGYLPLAHVLELSAEL 340
            .|.:||||:|||||..:||||.   |.|||   .|..       |||::...|||.|.   :..:
  Fly   345 LVYIYTSGTTGLPKAAVISHSRYLFIAAGIHYTMGFQ-------EEDIFYTPLPLYHT---AGGI 399

Human   341 VCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQ 405
            :|:......|    .|::.:..........|.:....|:...:.|:...|   :..|.||     
  Fly   400 MCMGQSVLFG----STVSIRKKFSASNYFADCAKYNATIGQYIGEMARYI---LATKPSE----- 452

Human   406 RNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCP 470
                   |:.|                  .:||.:.|..:|..:     .....||| ||   ..
  Fly   453 -------YDQK------------------HRVRLVFGNGLRPQI-----WPQFVQRF-NI---AK 483

Human   471 VGQGYGLTE----------SAGA-GTISEVW-----------DYNTG-----RVGAPLVCCEIKL 508
            ||:.||.||          :.|| |.:|.:.           |.:||     |.|    .|::..
  Fly   484 VGEFYGATEGNANIMNHDNTVGAIGFVSRILPKIYPISIIRADPDTGEPIRDRNG----LCQLCA 544

Human   509 KNWEEGGYFNTDKPHPRGEILIGGQS-VTMGYYKNEAKTK---ADFFEDENGQRWLCTGDIGEFE 569
            .|  |.|.|       .|:|:.|..| ..:||...:|..|   .|.|  ::|.....:||:...:
  Fly   545 PN--EPGVF-------IGKIVKGNPSREFLGYVDEKASAKKIVKDVF--KHGDMAFISGDLLVAD 598

Human   570 PDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTE 634
            ..|.|...||..|..:.: ||.||..:|||.      |.|:..|.:   :.|.|..:|:    ||
  Fly   599 EKGYLYFKDRTGDTFRWK-GENVSTSEVEAQ------VSNVAGYKD---TVVYGVTIPH----TE 649

Human   635 LARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFK 699
              .:.|:...::.       |.|:...:..|:::..|..:..|..|||..:.      .:|..||
  Fly   650 --GRAGMAAIYDP-------ERELDLDVFAASLAKVLPAYARPQIIRLLTKV------DLTGTFK 699

Human   700 LKRKELK 706
            |::.:|:
  Fly   700 LRKVDLQ 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 155/658 (24%)
Fatp1NP_001162940.3 PRK08279 153..746 CDD:236217 155/658 (24%)
hsFATP4_like 199..712 CDD:213305 146/615 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92684865
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.