DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tekt1 and CG17450

Sequence 1:NP_001268935.1 Gene:Tekt1 MGIID:1333819 Length:418 Species:Mus musculus
Sequence 2:NP_728438.2 Gene:CG17450 FlyBaseID:FBgn0040028 Length:601 Species:Drosophila melanogaster

Alignment Length:389 Identity:121/390 (31%)
Similarity:220/390 (56%) Gaps:0/390 (0%)


Mouse    10 RFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWK 74
            |:...|||..|.::|..:...|:.|||:..::.||:.|.::.....|.|..::|.:|:.::.||:
  Fly   206 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWR 270

Mouse    75 KELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKE 139
            .||:.:||:|:.:..|:...:.:..::|...:.||||.::||.:||.|.|.:.|||:||:.|..|
  Fly   271 NELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVE 335

Mouse   140 ADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKV 204
            .:.:....:.|....|:.::|....|.|::.||.|:..|.:::.||.:|..|||:|..|.:...:
  Fly   336 INNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGI 400

Mouse   205 VRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLK 269
            .:.:|:..:.|.|...|:.:|.::..:....:.|::....:::..|..:.......:.||....:
  Fly   401 EKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQ 465

Mouse   270 ETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQ 334
            |..:|:|::..||.||.:|:...||::..|:.||..:.||.|||.||||.|:||..||||:|.||
  Fly   466 EMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQ 530

Mouse   335 YRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIP 398
            .||::|:|:|...|..|...|.:|:...:.|.:.:..|:.:::.|.|.::||:..||.:|:|.|
  Fly   531 DRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tekt1NP_001268935.1 Tektin 16..395 CDD:281184 117/379 (31%)
CG17450NP_728438.2 Tektin 212..591 CDD:281184 117/379 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264325at33208
OrthoFinder 1 1.000 FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.