DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tcp1 and CCT1

Sequence 1:NP_038714.2 Gene:Tcp1 MGIID:98535 Length:556 Species:Mus musculus
Sequence 2:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster

Alignment Length:555 Identity:403/556 (72%)
Similarity:473/556 (85%) Gaps:2/556 (0%)


Mouse     1 MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGDVTITNDGATILKLL 65
            :..|||:.|.|.:|.:||:||||||.||:||||||.|||||||||||||||||:||||||||:||
  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLL 68

Mouse    66 EVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVR 130
            ||||||||||.|||.|||:|||||||||||:||||||||||||||||||||:|||||:|||||.:
  Fly    69 EVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACK 133

Mouse   131 YINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSV 195
            ||:|:|....||||||.|||.|||||||||||.:.::|:.|||||..:||.||.|||..|.:.::
  Fly   134 YISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAI 198

Mouse   196 NILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKL 260
            |:|||||:|..||:||.||||||.:.||.|||:|||||||||||||||||||:||||:|.||:||
  Fly   199 NVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKL 263

Mouse   261 DQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGA 325
            :.||.||.|||||||..||.||.||:|.:||:||:.:||||||||||||||.|.|||.:|||:||
  Fly   264 EAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGA 328

Mouse   326 SILSTLANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMER 390
            :.:::|.|::|||:|:.:|:|:|.||.|||||||||||||.||||.:|||||||.|||.||||||
  Fly   329 AFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMER 393

Mouse   391 SLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVN 455
            |:||||||||||||.|.||.|||.|||||||||||:|||:.|||||||||||:||||||.||:||
  Fly   394 SVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVN 458

Mouse   456 AAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEA 520
            ||:|:||||||||::||.:|..|||.:|||.||||:.|..||||:|||.||.:.|:|||||||||
  Fly   459 AAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEA 523

Mouse   521 AITILRIDDLIKLHPESKDDKHGSYENAVHSGALD 555
            |||||||||:|||:||.|..|  ||.:|..:|.||
  Fly   524 AITILRIDDMIKLNPEDKSGK--SYADACAAGELD 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tcp1NP_038714.2 chap_CCT_alpha 5..540 CDD:274081 395/535 (74%)
TCP1_alpha 9..535 CDD:239451 390/526 (74%)
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 395/535 (74%)
TCP1_alpha 12..538 CDD:239451 390/526 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158991866
eggNOG 1 0.900 E1_COG0459
Hieranoid 1 1.000
Homologene 1 1.000 H5656
Inparanoid 1 1.050 794 1.000 Inparanoid score I501
Isobase 1 0.950 0 Normalized mean entropy S29
OMA 1 1.010
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 1 1.000 T1082636
orthoMCL 1 0.900 OOG5_127998
Panther 1 1.100 LDO PTHR11353
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1484
TreeFam 1 0.960
1413.840

Return to query results.
Submit another query.