DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tbxas1 and Cyp6a8

Sequence 1:NP_035669.3 Gene:Tbxas1 MGIID:98497 Length:533 Species:Mus musculus
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:545 Identity:147/546 (27%)
Similarity:262/546 (48%) Gaps:73/546 (13%)


Mouse    14 TIVTVTLLVALLALLKWYSMSAFSRLEKLGIRHPKPSPFVGNLMFFRQG------FWESQLELRE 72
            |.:...:.|||||:|.:|.....:..::.||....|....||:...::.      |.:...:.||
  Fly     4 TYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRE 68

Mouse    73 RYGPLCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGL------EPKMVADSVLLLRDRR 131
            ...|..|::..:.....:.:.::.||:|:::||||||:   |:      :|  ::..:..|...:
  Fly    69 SKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNK---GIFYNEKDDP--ISAHLFNLDGAQ 128

Mouse   132 WEEVRGALMSSFSPEKLDEMTP-LISQACELL-VAHLKRYAASRDAFNIQRCYCCYTIDVVASVA 194
            |..:|..|.|:|:..|:..|.| ::|.|.|.: |.|.|  ........|:.....:|:||:.:.|
  Fly   129 WRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK--VPKNSVLEIRDLVARFTVDVIGTCA 191

Mouse   195 FGTQVDSQNSPEDPFVQHCRRASTFCIPRPLLV----------LILSFPSIMVPLARILPNKNRD 249
            ||.|.:|....:..|:...:|:         ||          .:.|:|.:...|..:   :...
  Fly   192 FGIQCNSLRDEKAEFLYFGKRS---------LVDKRHGTLLNGFMRSYPKLARKLGMV---RTAP 244

Mouse   250 ELNGFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPP 314
            .:..|::.::...:|:|:::  ..:|.||:.|:::.: :...:.:|..|:|              
  Fly   245 HIQEFYSRIVTETVAVREKE--HIKRNDFMDMLIELK-NQKEMTLENGDVV-------------- 292

Mouse   315 QRCHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHP 379
                     :..|::|::.|||:|.|||.|..::|:.|..|.||.:||.|:::..||:..:.:|.
  Fly   293 ---------RGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHD 348

Mouse   380 APEYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQR---IPAGTVLEIAVGALHHD 441
            ....:...:.|.||:.|:.||||:|.......|.||:...|.|..   |.||..:.|...|:|||
  Fly   349 QNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHD 413

Mouse   442 PEHWPNPETFDPERFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFEASP 506
            |..:|.|..|.||||:.|....|....:||||.|||:|:|:|.|.:..::.:..::..|:|....
  Fly   414 PSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCS 478

Mouse   507 ETQVPLQLESKS-ALGPKNGVYIKI 530
            :|..||..:.|| .||.|:|:|:|:
  Fly   479 KTPNPLVYDPKSFVLGVKDGIYLKV 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_035669.3 p450 47..530 CDD:278495 137/511 (27%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 137/509 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H130979
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.654 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.