DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myo5c and zip

Sequence 1:XP_006510998.1 Gene:Myo5c MGIID:2442485 Length:1749 Species:Mus musculus
Sequence 2:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster

Alignment Length:1915 Identity:493/1916 (26%)
Similarity:869/1916 (45%) Gaps:357/1916 (19%)


Mouse     7 YAQYNRVWIPDPEEVWKSAEIAKDYRAGDRVLRLLLEDG---MELEYPVDPGSLPPLRNPDILVG 68
            :.|...||:|...:.:.:|.|.:::  ||.|...|.|.|   |.|...:..      .||.....
  Fly    76 WTQKRLVWVPHENQGFVAASIKREH--GDEVEVELAETGKRVMILRDDIQK------MNPPKFDK 132

Mouse    69 ENDLTALSYLHEPAVLHNLRIRFAESKLIYTYSGIILVAMNPYKQLPIYGDAIIHAYSGQNMGDM 133
            ..|:..|:.|:|.:||||::.|: .|.|||||||:..|.:||||:||||.:.|:..|.|....::
  Fly   133 VEDMAELTCLNEASVLHNIKDRY-YSGLIYTYSGLFCVVVNPYKKLPIYTEKIMERYKGIKRHEV 196

Mouse   134 DPHIFAVAEEAYKQMARNNRNQSIIVSGESGAGKTVSARYAMRYFATVSKS-------------- 184
            .||:||:.:.||:.|..:..:|||:.:||||||||.:.:..:::.|.|:.|              
  Fly   197 PPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVL 261

Mouse   185 -----SSNAHVEDKVLA---------------------------------SNPITEAVGNAKTTR 211
                 ::|.:::.|::|                                 :|||.||.|||||.:
  Fly   262 INFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGNAKTVK 326

Mouse   212 NDNSSRFGKYTEISFDERNQIIGANMRTYLLEKSRVVFQSENERNYHIFYQLCASAQQSEFKHLK 276
            |||||||||:..|:||....|.|||:.||||||||.:.|:::||.:||||||.|.|...:.:...
  Fly   327 NDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFI 391

Mouse   277 LGSAEEFNYTRMGGNTVIEGVNDRADMVETQKTFTLLGFKKDFQMDVFKILAAILHLGNVQVTTV 341
            |...:.:.:. ..|:..:.||:|.|:...|.|:..::|...:....:|:|::|:|..|:::....
  Fly   392 LDDVKSYAFL-SNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQE 455

Mouse   342 GNERSSVSEDDSHLKVFCELLGLETSKVAQWLCNRKIVTSSETVVKPMTRPQAINARDALAKKIY 406
            .|...:...|::..:....||||..:.:.:.....:|....:.|.|..|:.|...|.:|:||..|
  Fly   456 RNNDQATLPDNTVAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACY 520

Mouse   407 AHLFDFIVEQINQALHFSGKQ-HTFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKL 470
            ..:|.::|.:||::|..:.:| .:|||:||:.|||.|::|||||.||||.||||||.||..:|.|
  Fly   521 ERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFIL 585

Mouse   471 EQEEYMKEDIPWTLIDF-YDNQPVIDLIEAKMGILELLDEECLLPHGTDENWLQKLYNNFVNKNS 534
            |||||.:|.|.|..||| .|.||.||||:...||:.||||||..|..||:.::.||    |:.:|
  Fly   586 EQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDKTFVDKL----VSAHS 646

Mouse   535 LFEKPRMSN----SSFIIQHFADKVEYQCEGFLEKNRDTVYDMLVEILRASKFHLCAAFFQESPV 595
            :..|...::    :.|.|.|:|.:|:|....:|.||.|.:.:.:|.:|:.|:.......::::.:
  Fly   647 MHPKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAEI 711

Mouse   596 PSSPFGAMITVKSAKQVIKPNTKHFRT------TVGNKFRSSLYLLMETLNATTPHYVRCIKPND 654
                      |..|:|.:.......||      ||.:.::..|..||:||..|.|::||||.||.
  Fly   712 ----------VGMAQQALTDTQFGARTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNH 766

Mouse   655 EKMPFEFDSKRIVQQLRACGVLETIRISAQSYPSRWTYLEFYSRYGILMTQQEL--SLSDKKEVC 717
            ||...:.|:..::.|||..||||.|||..|.:|:|..:.||..||. |:|...:  ...|.|:.|
  Fly   767 EKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYE-LLTPNVIPKGFMDGKKAC 830

Mouse   718 KVVLHRLIQDSNQYQFGRTKIFFRAGQVAYLEKLRLDKLRQDCIMIQKHVRGWLQRRKF---LRE 779
            :.::..|..|||.|:.|::|||||||.:|:||:.|..|:....:..|...||:|.||.:   |::
  Fly   831 EKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGFLARRNYQKRLQQ 895

Mouse   780 RQAALTIQR------------YFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRV 832
            ..|...|||            ::|....|:..:..|..:|.    ::||       .:..:.:|.
  Fly   896 LNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEK----LVQK-------EDELKQVRE 949

Mouse   833 ATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQNIRRFVLNIQ-LTYRVQRLQK 896
            ...|:..:|:.:  .|:|::.|.|...:..|..|...|.....::..|.:...| |...:|.|:.
  Fly   950 KLDTLAKNTQEY--ERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDMMQELET 1012

Mouse   897 KLEDQNRENHGLVEKLTSLAA------LRVGDL-EKVQKLEAELEKAATHRHSYEEKGRRYRDTV 954
            ::|::.       |::.:|..      |.:.|| |::::.||..:|....:...:.|.::|.:.:
  Fly  1013 RIEEEE-------ERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDL 1070

Mouse   955 EERLSKLQKHNAELELQRERAEQMLQEKSEE---------LKEKMDKLTRQLFDDVQKEEQQRLV 1010
            .....:.||...|.:|..|||..:.|..:||         ||.|.:....:|.:.:.|::|||  
  Fly  1071 ALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQR-- 1133

Mouse  1011 LEKGFELKTQAYEKQIESLREEIKALKDERSQLHHQLEEGQV----TSDRLKGEVARLSKQAKTI 1071
                     |..::....:..|:..||::.::...|::|.|.    ..:.|...:.|:.:::.|.
  Fly  1134 ---------QESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATK 1189

Mouse  1072 SEFEKEIELLQAQKIDVEKHVQSQK----------REMRERMSEVTKQLLESYDI----EDVRSR 1122
            :..:|....|::|..::::.::::|          |::.|.:..:..:||:|.|.    :::||:
  Fly  1190 ATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSK 1254

Mouse  1123 LSVEDLEHLNEDGELWFAYEGLKKATRVLESHFQSQKDCYEKEIEGLNFKVVHLSQEINHLQK-- 1185
                      .:.||....:.|::.|...|......:..:.:|:..:|.::.:|.:....|:|  
  Fly  1255 ----------REQELATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAK 1309

Mouse  1186 ---------LFREETDINESIRHEVTRLTSENMMIPDFKQQISELERQKQDLE---SRLKEQAEK 1238
                     |..|...:|.|.:....|.......|.:.:.:::|:||.:.:|:   ::|:::||.
  Fly  1310 GTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAEN 1374

Mouse  1239 IEGKLEE-----------------PFSHLNRIREEERMQGRAPHPFLRAVEAQSEMHPEGKERLV 1286
            |..:|||                 ..:...::.|||..|.......||.:|::       ||.|.
  Fly  1375 ITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESE-------KEALQ 1432

Mouse  1287 GAIHEPHEAIK-FPKKQPEAEEEVESILQQE------ASRLSLEKRDLEEELDMKDRMIRRLQDQ 1344
            ..:.|..||.: :.:|..|...:::.|.::.      |..|...|:.|.::::..:|.::.|..|
  Fly  1433 EQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQ 1497

Mouse  1345 VKTLTKTTEKANH------VHLPSGSREYLGMLEYKKEDEGKLIQNLILDLKPRGVVVNMIPGLP 1403
            ...|.|:.:|...      :.|.:...:.| .||.|:::..|::                     
  Fly  1498 NDRLDKSKKKIQSELEDATIELEAQRTKVL-ELEKKQKNFDKIL--------------------- 1540

Mouse  1404 AHILFMCVRYADSLNDANMLKSLMNSAINGIKHVVKEHF---EDLEMLSFWLSNTCHFLNCLKQY 1465
            |....:..:.|...:.|........:.:..:...:.|.|   ||||.....|.|.   |:.|...
  Fly  1541 AEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRKTLQNE---LDDLANT 1602

Mouse  1466 SGEEEFMKYNSPQQNKNCL---------NNFDLTEYRQILSDVAIRIYHQFIIVMENNLQPIIVP 1521
            .|..: ...:..::.|..|         .|.:|.:..|:..|..:|        :|.|:|.:  .
  Fly  1603 QGTAD-KNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLR--------LEVNMQAL--R 1656

Mouse  1522 GMLEYESLQGISGLKPTGFRKRSSSIDDTDAYTMTSILQQLSYFYSTMCQNGLDPEIVRQAVKQL 1586
            ...|.:.|....|.:    .||            ..:::||         ..|:.|:..:..::.
  Fly  1657 SQFERDLLAKEEGAE----EKR------------RGLVKQL---------RDLETELDEERKQRT 1696

Mouse  1587 FYLVGAVTLNSLLLRKDMCSCRKGMQIRCNISFLEEWLKD-KNVQSSL------------AKETL 1638
                 |...:...|..|:......|::...:.  |:.||. |.:|:.:            |||.|
  Fly  1697 -----AAVASKKKLEGDLKEIETTMEMHNKVK--EDALKHAKKLQAQVKDALRDAEEAKAAKEEL 1754

Mouse  1639 EPLSQ---------AAWLLQV----------KKTTDSDAKEIAQCCTSLSAVQIIKILNSYTPID 1684
            :.||:         .|.:||:          ::..:::..|:|:        :|....|..:.:.
  Fly  1755 QALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAE--------EIANNANKGSLMI 1811

Mouse  1685 DFEKRVNPSFVRKVQALLNNRGDSAQLMLD 1714
            | |||...:.:..::..|.....:::::||
  Fly  1812 D-EKRRLEARIATLEEELEEEQSNSEVLLD 1840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myo5cXP_006510998.1 Myosin_N 12..48 CDD:280832 12/39 (31%)
MYSc 62..752 CDD:214580 272/756 (36%)
MYSc_Myo5 81..741 CDD:276831 260/726 (36%)
IQ 830..851 CDD:197470 5/21 (24%)
COG1340 890..1150 CDD:224259 58/294 (20%)
RILP-like <952..1096 CDD:304877 31/157 (20%)
GBP_C <961..1030 CDD:303769 19/78 (24%)
coiled coil 1001..1010 CDD:293879 4/9 (44%)
coiled coil 1019..1030 CDD:293879 1/11 (9%)
Myo5c_CBD 1376..1743 CDD:271260 63/384 (16%)
zipNP_523860.2 Myosin_N 80..117 CDD:280832 12/39 (31%)
Myosin_head 133..854 CDD:278492 264/738 (36%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 260/726 (36%)
Myosin_tail_1 931..2011 CDD:279860 192/1036 (19%)
Prefoldin 1431..1515 CDD:298833 17/84 (20%)
FAM76 <1847..1926 CDD:292665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126577
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.