DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ERF and Ets96B

Sequence 1:NP_006485.2 Gene:ERF HGNCID:3444 Length:548 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster

Alignment Length:134 Identity:55/135 (41%)
Similarity:73/135 (54%) Gaps:10/135 (7%)


Human    27 IQLWHFILELLRKEEYQ-GVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRYYYN 90
            :|||.|::.||.:.... ..|||.|...||.:.:|:||||.||::|.:|.||||||||:|||||.
  Fly   498 LQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYE 562

Human    91 KRILHKTKGKRFTYKFNFNKLVLVN--YPFIDVGLAGGAVPQ------SAPPVPSGGSHFRFPPS 147
            |.|:.|..|:|:.|:|..:...|.|  |..:..|...|...|      ..||. ||.|..:.|..
  Fly   563 KGIMQKVNGERYVYRFVCDPD
ALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPT-SGDSQTQSPRV 626

Human   148 TPSE 151
            ..||
  Fly   627 AKSE 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ERFNP_006485.2 ETS 26..111 CDD:197710 41/85 (48%)
Atrophin-1 <126..383 CDD:331285 10/33 (30%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/85 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.