DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Serpina1a and Spn88Eb

Sequence 1:NP_001239498.1 Gene:Serpina1a MGIID:891971 Length:436 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster

Alignment Length:401 Identity:92/402 (23%)
Similarity:170/402 (42%) Gaps:59/402 (15%)


Mouse    73 DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSF 137
            ||:::|.:::.....:.|:||||.|...|..:....|...|..::.:.|.....      ::|..
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA------LNKQQ 98

Mouse   138 QHLLQTL-NRPD------SELQLSTGNGLFVNNDLKLVEKFLE---------EAKNHYQAEVFSV 186
            ..:..|| .|.|      |.::||:.|.:||:..:.:..||..         :.||         
  Fly    99 VLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKN--------- 154

Mouse   187 NFAESEEAKKVINDFVEKGTQGKIAEAV--KKLDQDTVFALANYILFKGKWKKPFDPENTEEAEF 249
               :.|...|.|||::...|..:|.:.:  :::...|:..|||....||:|...|..|.|....|
  Fly   155 ---DPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPF 216

Mouse   250 HVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDY----------------AGNATAVFLLPDD 298
            .::|.....|.||..:|...:.....|.|.::.:.|                ..:.:.:.:||:.
  Fly   217 FINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNS 281

Mouse   299 GKMQHLEQTLSK---ELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLS 360
            .|:. |.:.:|:   :.:.|:......:..::..|:........|..::|.:|:..:|...|...
  Fly   282 NKIS-LNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345

Mouse   361 GITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMS-MPPILRF--DHPFLFIIFEEHTQ 422
            .:|.:...|.:..|.|.|.:.:||.|:.|||.|:|.:...| .|...:|  :|||:|:|::|...
  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410

Mouse   423 SPIFLGKVVDP 433
            :.:|.|...||
  Fly   411 TILFAGVYSDP 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 89/397 (22%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 90/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.