DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox8 and Sox100B

Sequence 1:NP_035577.1 Gene:Sox8 MGIID:98370 Length:464 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:477 Identity:141/478 (29%)
Similarity:202/478 (42%) Gaps:122/478 (26%)


Mouse    46 GGGGRGDTAEAADERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGTLKAKPHVKRPMNAFMVWA 110
            |.|||.:     |||    |..||.:||:||||:||....:   ..|.:.|.|:|||||||||||
  Fly    36 GQGGRKE-----DER----ITTAVMKVLEGYDWNLVQASAK---APTDRKKEHIKRPMNAFMVWA 88

Mouse   111 QAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKS 175
            |||||.::.|||||.|:||||:|||||:.|.:|:|:||:|.||:||:.||::||||||||||:|:
  Fly    89 QAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKA 153

Mouse   176 -VKTGRSDSDSGTELGHHPGGPMYKADAVLGEAHHHSDHHTGQTHGPPTPPTTPKTDLHQASNGS 239
             |...:...:.|:.      ||.....|.:|.:            |.|           ::||.:
  Fly   154 RVLPSQQSGEGGSP------GPEMTLSATMGSS------------GKP-----------RSSNSN 189

Mouse   240 KQELRLEGRRLVDSGRQNIDFSNVDISELSSEVISNMDTFDVHEFDQYLPLNGHSALPTEPSQAT 304
            .|....:|....|.|......|:.::...||:|.||      ..|.:.|.....::|..:....|
  Fly   190 GQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSN------EAFMKSLNSACAASLMEQSLIET 248

Mouse   305 ASGSYGGASYSHSGATGIGASPVWAHKGAPS-ASASPTEAGPLRPQIKTEQLSPS---------- 358
            ...|....:.|.|..|    .|...:..||| |.||...    .|.:...|||..          
  Fly   249 GLDSPCSTASSMSSLT----PPATPYNVAPSNAKASAAN----NPSLLLRQLSEPVANAGDGYGV 305

Mouse   359 --------------HYNDQSHGSPGRAD----------------YGSYSA--------------- 378
                          :|..||.|....|:                ||.|:.               
  Fly   306 LLEAGREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGG 370

Mouse   379 -----QASVTTAASATAASSFASAQCDYTDLQASNYYSPYPGYPPSLYQYPYF-HSSRRP--YAS 435
                 :.....|..|:.|.::..|..|....:...|:.... .|.:.:.:|:. |....|  ::.
  Fly   371 HFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYFMDQM-LPMTQHHHPHHTHPLHHPLHHSP 434

Mouse   436 PLLNGLSMPPAHSPSSNWDQPV 457
            ||.:..|:..|.|.:|: .|||
  Fly   435 PLNSSASLSSACSSASS-QQPV 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox8NP_035577.1 Sox_N 18..86 CDD:315171 18/40 (45%)
SOX-TCF_HMG-box 98..168 CDD:238684 49/70 (70%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 49/70 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61594572
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I4333
Isobase 1 0.950 0 Normalized mean entropy S11712
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616410
orthoMCL 1 0.900 OOG5_141564
Panther 1 1.100 O PTHR45803
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5318
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.