DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox3 and Sox100B

Sequence 1:NP_033263.2 Gene:Sox3 MGIID:98365 Length:450 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:319 Identity:94/320 (29%)
Similarity:134/320 (42%) Gaps:88/320 (28%)


Mouse   141 QDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHM 205
            ::.:||||||||||::..||.|:.:.|.:.|||:||.||..||.|.|::|:||::.|::||..|.
  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138

Mouse   206 KEYPDYKYRPRRKTKTLLKKDKYSLPGGLLPPGAAAAAAAAAA-------------AAAASSPVG 257
            :|:|||||:||||...:|...: |..||...|....:|...::             |...::...
  Fly   139 QEHPDYKYQPRRKKARVLPSQQ-SGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAAD 202

Mouse   258 VGQRLDTYTHVNGWANG-----------------AYSLVQEQL---GYAQP----PSMSSPPPPP 298
            :|....|.:|.|..:|.                 |.||:::.|   |...|    .|||| ..||
  Fly   203 LGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSS-LTPP 266

Mouse   299 ALPQMHRYDMAGLQYSPMMPPGAQSYMNAAAAAA----------------AASGYGGMAPSAAAA 347
            |.|    |::|         |.     ||.|:||                |..|||.:..:....
  Fly   267 ATP----YNVA---------PS-----NAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREY 313

Mouse   348 AAAA----YGQQPATAAAAAAAAAAMSL----------GPMGSVVKSEPSSPPPAIASH 392
            .|..    .||.....:.|....|...:          |..||.| |.|:...||...|
  Fly   314 VAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRV-SYPAYSYPANGGH 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox3NP_033263.2 SOX-TCF_HMG-box 143..214 CDD:238684 38/71 (54%)
SOXp 213..306 CDD:289133 31/130 (24%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61725055
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.