DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox17 and Sox100B

Sequence 1:NP_001276393.1 Gene:Sox17 MGIID:107543 Length:419 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:516 Identity:135/517 (26%)
Similarity:182/517 (35%) Gaps:160/517 (31%)


Mouse     1 MSSPDAGYASDDQSQP---------------RSAQ------------PAVMAGLGPCPWAESLSP 38
            ||...:...|.|:::|               :.||            .|||..|....|      
  Fly     1 MSDSSSSNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDW------ 59

Mouse    39 LGDVKVKGEVVASSGAPAGTSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLG 103
                   ..|.||:.||..     :.:..|:||||||||||:..|:.:::|.|.|.|:||||.||
  Fly    60 -------NLVQASAKAPTD-----RKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLG 112

Mouse   104 KSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALG 168
            |.||.|..::|:||:|.||:||:.|.|:||:|||:|||:|            ...|...|:|   
  Fly   113 KLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKK------------ARVLPSQQSG--- 162

Mouse   169 PEGGRVAMDGLGLPFPEPGYPA-----GPPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLD 228
             |||.        |.||....|     |.|..|...|...   .|.|..|.|.....:..:....
  Fly   163 -EGGS--------PGPEMTLSATMGSSGKPRSSNSNGQRR---AGKGNAAADLGSCASTISHANV 215

Mouse   229 GVEQDPAF----FAAPLPGDCPAA---------GTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPA 280
            |......|    |...|...|.|:         |..:....:....|:.|||.|..|.|..    
  Fly   216 GSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPYNVAPSN---- 276

Mouse   281 MPGILAPPSALH---LYYGAMGSPAASAGRGFHAQPQQ--------PLQPQAPPPPPQQQHPAHG 334
                 |..||.:   |....:..|.|:||.|:....:.        .:..|......|......|
  Fly   277 -----AKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGGG 336

Mouse   335 PGQP------------------SPPPEALPCRDG---TESNQPTELL------------GEVDRT 366
            .||.                  |.|..:.|...|   ||..|..:.|            .::|..
  Fly   337 AGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAAADIDPK 401

Mouse   367 EFEQY-----LPFVYKPEMGLPYQGHDCGVNLS-----DSHGAISSVVSDASS----AVYY 413
            |.:||     ||......   |:..|.....|.     :|..::||..|.|||    |.||
  Fly   402 EIDQYFMDQMLPMTQHHH---PHHTHPLHHPLHHSPPLNSSASLSSACSSASSQQPVAEYY 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox17NP_001276393.1 SOX-TCF_HMG-box 67..138 CDD:238684 41/71 (58%)
Sox_C_TAD 202..417 CDD:288887 59/284 (21%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.