DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Slc25a14 and CG1907

Sequence 1:NP_001277634.1 Gene:Slc25a14 MGIID:1330823 Length:344 Species:Mus musculus
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:312 Identity:102/313 (33%)
Similarity:166/313 (53%) Gaps:19/313 (6%)


Mouse    38 SSAELEQHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIK 102
            |:..:::..|.:..::.:.      |::|||:.:.|.....|:||.|||:|:.|.....:    :
  Fly     2 SATSVQEAPKKAVATNAIK------FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----E 56

Mouse   103 YRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLE-DETLLINMIC 166
            ||...|.:..|..:||.||||.||..||||||:|.|.::|:|..|..||.|:.: ...:..:|..
  Fly    57 YRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAM 121

Mouse   167 GVVSGVISSTIANPTDVLKIRMQAQGSL------FQGSMIGSFIDIYQQEGTRGLWRGVVPTAQR 225
            |.::|...:.|..|.:|..:||.:.|.|      ...::..:...|.::||...||||.:||..|
  Fly   122 GTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGR 186

Mouse   226 AAIVVGVELPVYDITKKHLIVSGM-LGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIV 289
            |.:|...:|..|...|.:.....: :.:.|..||.:|...||...:.|.|:|:.:||:.|.:.:.
  Fly   187 AMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD 251

Mouse   290 GHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 341
            |..: |:||.|.:|::.:.||.|||:|||.|.:.||||..::.||..|||.:
  Fly   252 GKPE-YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slc25a14NP_001277634.1 Mito_carr 59..155 CDD:278578 39/96 (41%)
Mito_carr 156..245 CDD:278578 25/96 (26%)
Mito_carr 253..342 CDD:278578 36/90 (40%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 39/103 (38%)
Mito_carr 118..207 CDD:278578 25/89 (28%)
Mito_carr 219..307 CDD:278578 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.