DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rras and Rap1

Sequence 1:NP_033127.1 Gene:Rras MGIID:98179 Length:218 Species:Mus musculus
Sequence 2:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster

Alignment Length:189 Identity:93/190 (49%)
Similarity:122/190 (64%) Gaps:8/190 (4%)


Mouse    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMR 94
            :|:||:|.|||||||||:||:|..||..|||||||||.|...|||....|:||||||.|:|.|||
  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68

Mouse    95 EQYMRAGNGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASS 159
            :.||:.|.||:||::|..:.:||::..|..|||||||.||.|:||||||.|||.:|.|.:....:
  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133

Mouse   160 FSASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL 218
            .:...:..:.|.|||.::||::.|..|||.:.|        ..|...:||.....||||
  Fly   134 LATQFNCAFMETSAKAKVNVNDIFYDLVRQINK--------KSPEKKQKKPKKSLCVLL 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RrasNP_033127.1 M_R_Ras_like 28..191 CDD:133345 85/161 (53%)
Effector region 58..66 8/8 (100%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 85/161 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.