DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX3 and COX3

DIOPT Version :8

Sequence 1:YP_009047271.1 Gene:COX3 / 19893540 FlyBaseID:FBgn0013676 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_009328.1 Gene:COX3 / 854627 SGDID:S000007283 Length:269 Species:Saccharomyces cerevisiae

Alignment Length:267 Identity:116/268 (43%)
Similarity:160/268 (60%) Gaps:12/268 (4%)


  Fly     2 STHSNHPFHLVDYSPWP-------LTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWW 59
            |.|..||||:|..||||       |:.|:....|:.|.:...:...::||||     :.:...|:
Yeast     7 SRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVL-----LTSSILWF 66

  Fly    60 RDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIIS 124
            ||:..|.||.|.||.||..|:..|.::|:|||||.|...|||:|||::||.:.|||.|||:||.:
Yeast    67 RDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEA 131

  Fly   125 FNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTI 189
            ..|.::|||||.|||:||.|||::||:|:..|.::...||..|..|.:.|...|..||..|.|||
Yeast   132 VQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTI 196

  Fly   190 ADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLY 254
            :|.:|||.|:..||.|.:|:::....|.|...|..|.|.:..||.|:|....|.|.:||:|||||
Yeast   197 SDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLY 261

  Fly   255 ITIYWWG 261
            :..||||
Yeast   262 VVFYWWG 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX3YP_009047271.1 COX3 4..258 CDD:214439 111/261 (43%)
COX3NP_009328.1 COX3 12..269 CDD:278911 114/263 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234250126
eggNOG 1 0.900 E1_COG1845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002948
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128583
Panther 1 1.100 LDO PTHR11403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.