DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX3 and AT2G07687

DIOPT Version :8

Sequence 1:YP_009047271.1 Gene:COX3 / 19893540 FlyBaseID:FBgn0013676 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_178782.1 Gene:AT2G07687 / 815364 AraportID:AT2G07687 Length:265 Species:Arabidopsis thaliana

Alignment Length:264 Identity:147/264 - (55%)
Similarity:187/264 - (70%) Gaps:2/264 - (0%)


  Fly     1 MSTHSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYD--ISLFVLGNIITILTVYQWWRDVS 63
            |.....|.:||||.||||::|::||:.|..|.|.:.|.:.  ..|..||.|..:.|::.|||||.
plant     1 MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHPFQGGARLLSLGLIFILYTMFVWWRDVL 65

  Fly    64 REGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPF 128
            ||.|.:|.||..|.:|.|:|.||||:|||:||.:||||..||||:||:|:|..|||.||...:|:
plant    66 RESTLEGHHTKVVQLGPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPPKGIEVLDPW 130

  Fly   129 QIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSI 193
            :||.|||.||.:||..||||||:::.....:....|..||||.:.||..|..||.:|||||:|||
plant   131 EIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVFTGFQGMEYYQAPFTISDSI 195

  Fly   194 YGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIY 258
            ||||||:||||||.||:|||.||::|.:|....|.:|.||.|||||||||||||||||||:::||
plant   196 YGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIY 260

  Fly   259 WWGG 262
            ||||
plant   261 WWGG 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX3YP_009047271.1 COX3 4..258 CDD:214439 140/255 (55%)
AT2G07687NP_178782.1 PLN02194 1..265 CDD:177845 147/264 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 338 1.000 Inparanoid score I634
OMA 1 1.010
OrthoDB 1 1.010 D1304563at2759
OrthoInspector 1 1.000 T193225
orthoMCL 1 0.900 OOG5_128583
Panther 1 1.100 LDO PTHR11403
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.