DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX3 and COX3

DIOPT Version :8

Sequence 1:YP_009047271.1 Gene:COX3 / 19893540 FlyBaseID:FBgn0013676 Length:262 Species:Drosophila melanogaster
Sequence 2:YP_203376.1 Gene:COX3 / 3283498 ID: Length:261 Species:Xenopus tropicalis

Alignment Length:258 Identity:169/258 - (65%)
Similarity:200/258 - (77%) Gaps:0/258 - (0%)


  Fly     4 HSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTY 68
            |..|.:|:||.||||||||:.|:...||:..|||...:.|..||.|..|||:.|||||:.||||:
 Frog     3 HQAHAYHMVDPSPWPLTGAVAALLLTSGLAMWFHFGSLILLTLGLITMILTMIQWWRDIIREGTF 67

  Fly    69 QGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPLL 133
            ||.||..|..|||:||||||.|||.||:.|||||::|||:|..|||..|||.||...|||::|||
 Frog    68 QGHHTPPVQKGLRYGMILFITSEVFFFIGFFWAFYNSSLAPTYELGECWPPTGITPLNPFEVPLL 132

  Fly   134 NTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTF 198
            |||:||||||||||||||:|..|..:..|.|..|:|||:|||.|||.||.||||||||.:|||||
 Frog   133 NTAVLLASGVTVTWAHHSIMHGNRKEAIQSLGLTILLGLYFTALQAMEYYEAPFTIADGVYGSTF 197

  Fly   199 FMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWG 261
            |:||||||:||:||:.||.||.:|.:..||:..|||||||||||||||||||||||::|||||
 Frog   198 FVATGFHGLHVIIGSLFLSVCFIRQIQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX3YP_009047271.1 COX3 4..258 CDD:214439 164/253 (65%)
COX3YP_203376.1 COX3 1..261 CDD:177179 169/258 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 383 1.000 Inparanoid score I1885
OMA 1 1.010
OrthoDB 1 1.010 D1304563at2759
OrthoFinder 1 1.000 FOG0002948
OrthoInspector 1 1.000 T1058632
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R246
TreeFam 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.