DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX3 and cox3

DIOPT Version :8

Sequence 1:YP_009047271.1 Gene:COX3 / 19893540 FlyBaseID:FBgn0013676 Length:262 Species:Drosophila melanogaster
Sequence 2:YP_009144713.1 Gene:cox3 / 24573142 ID: Length:269 Species:Saccharomyces cerevisiae

Alignment Length:267 Identity:117/267 - (43%)
Similarity:161/267 - (60%) Gaps:12/267 - (4%)


  Fly     2 STHSNHPFHLVDYSPWP-------LTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWW 59
            |.|..||||:|..||||       |:.|:....|:.|.:...:...::||||     :.:...|:
Yeast     7 SRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVL-----LTSSILWF 66

  Fly    60 RDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIIS 124
            ||:..|.||.|.||.||..|:..|.::|:|||||.|...|||:|||::||.:.|||.|||:||.:
Yeast    67 RDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEA 131

  Fly   125 FNPFQIPLLNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTI 189
            ..|.::|||||.|||:||.|||::||:|:..|.::...||..|..|.:.|...|..||..|.|||
Yeast   132 VQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTI 196

  Fly   190 ADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLY 254
            :|.:|||.|:..||.|.:|:::....|.|...|..|.|.:..||.|:|....|.|.:||:|||||
Yeast   197 SDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLY 261

  Fly   255 ITIYWWG 261
            :|.||||
Yeast   262 VTFYWWG 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX3YP_009047271.1 COX3 4..258 CDD:214439 112/260 (43%)
cox3YP_009144713.1 COX3 12..269 CDD:278911 115/262 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I675
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002948
OrthoInspector 1 1.000 T1135656
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R246
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.