DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX3 and COX3

DIOPT Version :8

Sequence 1:YP_009047271.1 Gene:COX3 / 19893540 FlyBaseID:FBgn0013676 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_904334.1 Gene:COX3 / 17710 MGIID:102502 Length:261 Species:Mus musculus

Alignment Length:259 Identity:172/260 (66%)
Similarity:203/260 (78%) Gaps:0/260 (0%)


  Fly     3 THSNHPFHLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGT 67
            ||..|.:|:|:.||||||||..|:...||:|.|||...|:|..||.:..|||:|||||||.||||
Mouse     2 THQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGT 66

  Fly    68 YQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPMGIISFNPFQIPL 132
            |||.||..|..|||:||||||:|||.||..|||||:||||.|..:||..|||.||...||.::||
Mouse    67 YQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGISPLNPLEVPL 131

  Fly   133 LNTAILLASGVTVTWAHHSLMENNHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGST 197
            |||::||||||::|||||||||...:...|.|..|::||:|||||||.||.|..|:|:|.|||||
Mouse   132 LNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGST 196

  Fly   198 FFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWG 261
            |||||||||:||:||:|||:|||||.|..||:..|||||||||||||||||||||||::|||||
Mouse   197 FFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX3YP_009047271.1 COX3 4..258 CDD:214439 167/254 (66%)
COX3NP_904334.1 COX3 1..261 CDD:177161 172/260 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I1979
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002948
OrthoInspector 1 1.000 T1082610
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11403
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R246
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.