DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44250 and CG31086

DIOPT Version :10

Sequence 1:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_733139.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:142 Identity:76/142 - (53%)
Similarity:101/142 - (71%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHY 78
            ::|:|.| ...:|..||:.|||||...|::||:|:..:.||||::|:||.|||||...|....:|
  Fly     4 HSWLHFS-NGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENY 67

  Fly    79 EVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQE 143
            |||.|..:.|:|:.:|.|||.||:.|....||.||.|||:||||||||||||||||||||:..:|
  Fly    68 EVLSGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEE 132

  Fly   144 VRINTYEVLIKQ 155
            |:|..||||.::
  Fly   133 VKIFAYEVLSRR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44250NP_001163133.1 DUF3421 36..146 CDD:463390 62/109 (57%)
DUF3421 179..288 CDD:463390
CG31086NP_733139.1 DUF3421 25..135 CDD:463390 62/109 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.