powered by:
Protein Alignment CG45122 and smkr1
DIOPT Version :9
| Sequence 1: | NP_001287309.1 |
Gene: | CG45122 / 19835488 |
FlyBaseID: | FBgn0266615 |
Length: | 86 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001289402.1 |
Gene: | smkr1 / 103910385 |
-ID: | - |
Length: | 91 |
Species: | Danio rerio |
| Alignment Length: | 84 |
Identity: | 37/84 - (44%) |
| Similarity: | 46/84 - (54%) |
Gaps: | 11/84 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 KKKRNSKDSTSSNAGSGEGEEKKKKEGGKKKGGVGKS--IGCDIFNDAAMENAYYVCHNVQDVLK 68
||.| |.|:.|.| :.|:|...||:....|: ...||.:.|||||.||:.||..|.|:
Zfish 13 KKSR----SQSARAAS----KSKRKRSSKKRSVSAKASKTDVDILSPAAMENVYYISHNAVDCLE 69
Fly 69 SRGFAWPDGQKKK-KKGKR 86
.|||.||...||| ||||:
Zfish 70 FRGFGWPGATKKKGKKGKK 88
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I10614 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
60 |
1.000 |
Inparanoid score |
I5401 |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0015091 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto39624 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_112552 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR37932 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X11926 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.960 |
|
Return to query results.
Submit another query.