DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG45122 and smkr1

Sequence 1:NP_001287309.1 Gene:CG45122 FlyBaseID:FBgn0266615 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001289402.1 Gene:smkr1 ID: Length:91 Species:Danio rerio

Alignment Length:84 Identity:37/85 (44%)
Similarity:46/85 (54%) Gaps:11/85 (13%)


  Fly     6 KKKRNSKDSTSSNAGSGEGEEKKKKEGGKKKGGVGKS--IGCDIFNDAAMENAYYVCHNVQDVLK 68
            ||.|    |.|:.|.|    :.|:|...||:....|:  ...||.:.|||||.||:.||..|.|:
Zfish    13 KKSR----SQSARAAS----KSKRKRSSKKRSVSAKASKTDVDILSPAAMENVYYISHNAVDCLE 69

  Fly    69 SRGFAWPDGQKKK-KKGKR 86
            .|||.||...||| ||||:
Zfish    70 FRGFGWPGATKKKGKKGKK 88



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011076
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.