DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45122 and SMKR1

DIOPT Version :10

Sequence 1:NP_001287309.1 Gene:CG45122 / 19835488 FlyBaseID:FBgn0266615 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_024302388.1 Gene:SMKR1 / 100287482 HGNCID:43561 Length:84 Species:Homo sapiens


Alignment Length:81 Identity:37/81 - (45%)
Similarity:42/81 - (51%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGSGE-------GEEKKKKEGGKKKGGVGKSIG-------CDIFNDAAMENAYYVCHNVQDVLKS 69
            :||||       .|.:..|  |||..|.|||.|       .||.:.|||.|.||:.|||.|.|..
Human     5 SGSGESTTPACSAENRHAK--GKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHL 67

  Fly    70 RGFAWPDGQKKKKKGK 85
            |||.|| |..|.|||:
Human    68 RGFHWP-GAPKGKKGR 82

Return to query results.
Submit another query.