DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG45122 and SMKR1

Sequence 1:NP_001287309.1 Gene:CG45122 FlyBaseID:FBgn0266615 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_024302388.1 Gene:SMKR1 HGNCID:43561 Length:84 Species:Homo sapiens

Alignment Length:81 Identity:37/82 (45%)
Similarity:42/82 (51%) Gaps:17/82 (21%)


  Fly    19 AGSGE-------GEEKKKKEGGKKKGGVGKSIG-------CDIFNDAAMENAYYVCHNVQDVLKS 69
            :||||       .|.:..|  |||..|.|||.|       .||.:.|||.|.||:.|||.|.|..
Human     5 SGSGESTTPACSAENRHAK--GKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHL 67

  Fly    70 RGFAWPDGQKKKKKGK 85
            |||.|| |..|.|||:
Human    68 RGFHWP-GAPKGKKGR 82



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011076
OrthoInspector 1 1.000 T1072143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR37932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.