DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45122 and SMKR1

DIOPT Version :9

Sequence 1:NP_001287309.1 Gene:CG45122 / 19835488 FlyBaseID:FBgn0266615 Length:86 Species:Drosophila melanogaster
Sequence 2:XP_024302388.1 Gene:SMKR1 / 100287482 HGNCID:43561 Length:84 Species:Homo sapiens


Alignment Length:81 Identity:37/81 - (45%)
Similarity:42/81 - (51%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGSGE-------GEEKKKKEGGKKKGGVGKSIG-------CDIFNDAAMENAYYVCHNVQDVLKS 69
            :||||       .|.:..|  |||..|.|||.|       .||.:.|||.|.||:.|||.|.|..
Human     5 SGSGESTTPACSAENRHAK--GKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHL 67

  Fly    70 RGFAWPDGQKKKKKGK 85
            |||.|| |..|.|||:
Human    68 RGFHWP-GAPKGKKGR 82



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11334
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5444
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0015091
OrthoInspector 1 1.000 - - oto90990
orthoMCL 1 0.900 - - OOG6_112552
Panther 1 1.100 - - LDO PTHR37932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11926
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.