DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and CG4404

DIOPT Version :8

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster

Alignment Length:449 Identity:88/450 (20%)
Similarity:149/450 (33%) Gaps:173/450 (38%)


  Fly     4 KKSTIVLNVEQFIHDIEERPAIWNRNF--HCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNF 66
            :|...|.|| :|:..:|.:|.:||...  :..|..:::.|.:::...|......:.:|:.:|.:|
  Fly     8 RKDDPVFNV-RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSF 71

  Fly    67 RVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTV 131
             :...::.|...|         ..|..:|     |:.:::..:|         |: :|..|.|.:
  Fly    72 -LRSLKLARTQTG---------RGKRKYY-----LSKYLQFLVP---------FT-KSRSCHKQL 111

  Fly   132 VEPDLTNGLIRRL--QDSDEDYDEEEMEADGEA--SEATMEETMPTPPAAHQMNQVSTTPLATGA 192
                  .|::.|.  |.:....::|.:.|:.||  |:..|...:......|:.||.......|..
  Fly   112 ------PGMVLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQVSEEEHRRNQEQDREQPTAC 170

  Fly   193 LRAQEEAHQHALIKAGLLRAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVEPPAA------ 251
            |.               ||...:::|.::.:.:      ||:...|  |.|.||..|||      
  Fly   171 LP---------------LRLHSIKVEHDSSNAN------QQLERMV--SQQSLVSVPAAALGNHL 212

  Fly   252 -----------HCSPPPMVTTTSAQVQQPGSAAVLAPATTTSASSVSSNGAPMGGKRSVSPPPLY 305
                       |.|....:|||                |||                ..||||..
  Fly   213 GWSDLTQWFKGHGSGHHKLTTT----------------TTT----------------PTSPPPPP 245

  Fly   306 NKAHHPLATLAAAHLAAKDRNEDFGPTSAVGGNGDHLSFTQHSYANGLIPALKLKRPRLSEDSNF 370
            ..|...|:....            ||    ||.|..                             
  Fly   246 QPATSALSVFTG------------GP----GGGGSQ----------------------------- 265

  Fly   371 NGSSTMDTPLVPEDDDYHYLLSLHPYMKQLTAAQKLRIRTKIQKLIFKELYKEDLEESK 429
                        .|.||.:|:|||||:|::...|..:.|.|:..||      :|:.::|
  Fly   266 ------------PDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLI------DDILDNK 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 16/94 (17%)
BESS 384..418 CDD:281011 15/34 (44%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/111 (16%)
BESS 267..301 CDD:281011 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.