DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45071 and madf-4

DIOPT Version :8

Sequence 1:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans

Alignment Length:273 Identity:57/274 (21%)
Similarity:99/274 (36%) Gaps:57/274 (21%)


  Fly    16 IHDIEERPAIWNRNFHCNKA--FLEQMWDELS---GAHKLPKIVLKAKWKGLRDNFRVEYKRIPR 75
            |..::..|.::||....:|.  :..::|..:|   |....| :.|:.|||.:||    :|.|:.:
 Worm    23 IDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQP-VELERKWKHMRD----KYVRLRK 82

  Fly    76 ADNGDFMVDPATFESKWLHYY-ALLFLTDHMRHRLPKNEQDQSFYFSQQSED------------C 127
            .|.   ...|....:||.:|| .:.||..::.||..|.::|   |.:..:.|            .
 Worm    83 QDK---QKAPIKKTNKWYNYYHKMSFLDPYVEHRNRKRQKD---YLNSNTPDFLDDDTAFLDGLS 141

  Fly   128 EKTVVEPDLTNGLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATG- 191
            .|.:::|:      ..|..:|..|:.....:...:|.:.........|.....:......|... 
 Worm   142 VKEMLKPE------SLLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDIEDDKKNLALIYDK 200

  Fly   192 --ALRAQEEAHQHALIKAG---LLRAQLMELEKEA-------EDLSRKP---------PPPQQMT 235
              |.:.:.|.:.....|.|   |.......:||.|       ....|||         ||||:..
 Worm   201 FVANQTENEKNHRFSNKHGKDLLFSTTNTLIEKLATTSTAPSSSRKRKPIPVQILPSSPPPQEKN 265

  Fly   236 SPVAPSLQVLVEP 248
            :.:.....:|.||
 Worm   266 TKIELLEDILNEP 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG45071NP_730024.1 MADF 14..106 CDD:214738 25/96 (26%)
BESS 384..418 CDD:281011
madf-4NP_505565.3 MADF 22..111 CDD:214738 25/96 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.