DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45488 and CG45491

DIOPT Version :8

Sequence 1:NP_001285469.1 Gene:CG45488 / 19834833 FlyBaseID:FBgn0267044 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001285472.1 Gene:CG45491 / 19835590 FlyBaseID:FBgn0267047 Length:92 Species:Drosophila melanogaster

Alignment Length:90 Identity:85/91 (93%)
Similarity:86/91 (95%) Gaps:0/91 (0%)


  Fly     1 MSQKKSNISHLVIQCIDAMGGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65
            |||||||||||||||||||.||||||:||||||.|||||||||||||||||||||||||||.|||
  Fly     1 MSQKKSNISHLVIQCIDAMDGFASKEMILKAVSKATDKKFWKMGRRIDDALDTLIVDGVIRKHND 65

  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90
            ||||||||||||.||||||||||||
  Fly    66 NYYLNMLEETASDSHCNSGSDSDSD 90



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141572169
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.