DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45488 and CG45491

DIOPT Version :10

Sequence 1:NP_001285469.1 Gene:CG45488 / 19834833 FlyBaseID:FBgn0267044 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001285472.1 Gene:CG45491 / 19835590 FlyBaseID:FBgn0267047 Length:92 Species:Drosophila melanogaster


Alignment Length:90 Identity:85/90 - (94%)
Similarity:86/90 - (95%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQKKSNISHLVIQCIDAMGGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65
            |||||||||||||||||||.||||||:||||||.|||||||||||||||||||||||||||.|||
  Fly     1 MSQKKSNISHLVIQCIDAMDGFASKEMILKAVSKATDKKFWKMGRRIDDALDTLIVDGVIRKHND 65

  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90
            ||||||||||||.||||||||||||
  Fly    66 NYYLNMLEETASDSHCNSGSDSDSD 90

Return to query results.
Submit another query.