DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45488 and CG45154

DIOPT Version :9

Sequence 1:NP_001285469.1 Gene:CG45488 / 19834833 FlyBaseID:FBgn0267044 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001285514.1 Gene:CG45154 / 19835236 FlyBaseID:FBgn0266647 Length:89 Species:Drosophila melanogaster


Alignment Length:90 Identity:67/90 - (74%)
Similarity:75/90 - (83%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQKKSNISHLVIQCIDAMGGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65
            |||:||:||||||||||||||||||.||.||:|||||:|...:|.||:||||.|||.||||.||.
  Fly     1 MSQQKSDISHLVIQCIDAMGGFASKSVIPKALSTATDRKILNIGSRIEDALDKLIVQGVIRKHNG 65

  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90
            ||||||.|.|||.|||:|.|: |||
  Fly    66 NYYLNMQERTASDSHCHSDSE-DSD 89



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007608
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.