DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45488 and CG45154

DIOPT Version :10

Sequence 1:NP_001285469.1 Gene:CG45488 / 19834833 FlyBaseID:FBgn0267044 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001285514.1 Gene:CG45154 / 19835236 FlyBaseID:FBgn0266647 Length:89 Species:Drosophila melanogaster


Alignment Length:90 Identity:67/90 - (74%)
Similarity:75/90 - (83%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQKKSNISHLVIQCIDAMGGFASKEVILKAVSTATDKKFWKMGRRIDDALDTLIVDGVIRTHND 65
            |||:||:||||||||||||||||||.||.||:|||||:|...:|.||:||||.|||.||||.||.
  Fly     1 MSQQKSDISHLVIQCIDAMGGFASKSVIPKALSTATDRKILNIGSRIEDALDKLIVQGVIRKHNG 65

  Fly    66 NYYLNMLEETASASHCNSGSDSDSD 90
            ||||||.|.|||.|||:|.|: |||
  Fly    66 NYYLNMQERTASDSHCHSDSE-DSD 89

Return to query results.
Submit another query.