DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EEF1G and GstD2

Sequence 1:NP_001395.1 Gene:EEF1G HGNCID:3213 Length:437 Species:Homo sapiens
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:183 Identity:46/184 (25%)
Similarity:87/184 (47%) Gaps:17/184 (9%)


Human    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSDI 106
            |||::..|...:|... |:||.::||.|||.|:     .::.|..:.|:..|.:.|.:.|....:
  Fly    41 PEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVE
KYGKDDYLLPNDPKKRAVINQRLYFDMGTL 104

Human   107 VPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWL 171
            ....:.:.:|   :....|..::...:.:....|.||.:|:.:.::.|:::|:|||.::.|:...
  Fly   105 YESFAKYYYP---LFRTGKPGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTF 166

Human   172 YKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGE--VKLCEKMAQFDAKKFA 222
              :|.|..|.: :.|.:||:   .|..:......|  ..|....|.|||:|.|
  Fly   167 --EVSEFDFSK-YSNVSRWY---DNAKKVTPGWDENWEGLMAMKALFDARKLA 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EEF1GNP_001395.1 GST_N_EF1Bgamma 4..82 CDD:239342 14/40 (35%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 24/124 (19%)
V-ATPase_G_2 <212..>278 CDD:330366 6/12 (50%)
EF1G 277..381 CDD:306993
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 14/34 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/125 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.