DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptpn22 and PTP-ER

Sequence 1:NP_033005.1 Gene:Ptpn22 MGIID:107170 Length:802 Species:Mus musculus
Sequence 2:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster

Alignment Length:515 Identity:111/516 (22%)
Similarity:158/516 (31%) Gaps:255/516 (49%)


Mouse     2 DQREILQQLLKEAQKKKLNSEE----FASEFLKLKRQSTKYKADKIYPTTVAQRPKNIKKNRYKD 62
            :|:.|.:.|.||.....||.:|    |.|:                            .|||||.
  Fly   887 EQKRIFRDLHKEFWDLPLNHQEKPMVFGSQ----------------------------TKNRYKT 923

Mouse    63 ILPYDHSLVEL-----------------SLLTSDEDSSYINASFIKGV-YGPKAYIATQGPLSTT 109
            |||.::|.|.|                 |.:|:.||..||||::|||. |..|.|:||||||..|
  Fly   924 ILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNT 988

Mouse   110 LLDFWRMIWE----------------------YRIL-----VIVMACMEFEMGKKKCERYWAEPG 147
            :.:||.||::                      .:||     .|||.....|..::||..|:  |.
  Fly   989 IFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYF--PI 1051

Mouse   148 ETQLQFG------PFSISCEAEK------------------------------------------ 164
            |....|.      .|.:|..|..                                          
  Fly  1052 ELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEG 1116

Mouse   165 ---------------------KKSDYKIRTL----------KAKFNNETRIIYQFHYKNWPDHDV 198
                                 :::.|.:|.|          .|.::.:....|.:.|.:||||..
  Fly  1117 DLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHS 1181

Mouse   199 PSSIDPILQL---------------IWD--------------MRCYQED-----DCVPICIHCSA 229
            |..|:.:|..               |:|              :..||:|     ..:|: |||||
  Fly  1182 PRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV-IHCSA 1245

Mouse   230 GCGRTGVICAV-------------DYTWMLLKD-------------------------------- 249
            |.||||...|:             ..|.||.|.                                
  Fly  1246 GIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILD 1310

Mouse   250 -------------GIIPKNFSVF----NLIQEMRTQRPSLVQTQEQYELVYSAVLELFKR 292
                         ..:||...:|    .::..:|.||..:||..|||||::.|:....||
  Fly  1311 HRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKR 1370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptpn22NP_033005.1 PTPc 24..288 CDD:214550 101/484 (21%)
PTPc 56..288 CDD:238006 99/452 (22%)
Substrate binding. {ECO:0000250} 227..233 5/6 (83%)
Interaction with CSK. {ECO:0000269|PubMed:8890164} 613..621
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 99/479 (21%)
PTPc 917..1364 CDD:238006 99/450 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.