DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptpn1 and PTP-ER

Sequence 1:NP_035331.3 Gene:Ptpn1 MGIID:97805 Length:432 Species:Mus musculus
Sequence 2:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster

Alignment Length:478 Identity:88/479 (18%)
Similarity:146/479 (30%) Gaps:226/479 (47%)


Mouse    19 IYQDIRHEASDFPCKVAKLPK---NKNRNRYRDVSPFDHSRIKLHQEDND--------------- 65
            |::|:..|..|.|....:.|.   ::.:|||:.:.|.::||:.|..|.::               
  Fly   891 IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVT 955

Mouse    66 ------YINASLIK-MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSR------------------ 105
                  ||||:.|| .:...:.|:.||||||||...||.|:::...|                  
  Fly   956 ASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDR 1020

Mouse   106 ---------GVVMLNRIMEKGSLKCAQYWPQQEEKEMV-----------------FD-------- 136
                     .:|||....|....|||.|:|.:..:...                 ||        
  Fly  1021 EQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFV 1085

Mouse   137 -DT--------------------GLKLTLISEDVK------SYYTVRQLELENLTTKETREIL-- 172
             ||                    .:|:||..:.::      |::.::.:.:........|:::  
  Fly  1086 PDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLL 1150

Mouse   173 -------------------HFHYTTWPDFGVPESPASFLNFLFKVRESGSLSLEHG--------- 209
                               |:.|..|||...|....:.|:....|...|....|..         
  Fly  1151 YCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSER 1215

Mouse   210 ---------------------PI-VVHCSAGIGRSGTFCLADTCLL------------------- 233
                                 |: |:||||||||:|.|    |.:|                   
  Fly  1216 NAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCF----TAILNAVRQLRQSLAYSLTGMLT 1276

Mouse   234 -------------------------------LMDKR-----KDPSS-----------VDIKKVLL 251
                                           ::|.|     |.|.|           ||:..::.
  Fly  1277 KSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVC 1341

Mouse   252 EMRRFRMGLIQTADQLRFSYLAV 274
            .:|..|.|::|.::|....:.|:
  Fly  1342 NLRLQRGGMVQNSEQYELIHRAI 1364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptpn1NP_035331.3 PTPc 3..276 CDD:214550 88/479 (18%)
PTPc 43..276 CDD:238006 82/452 (18%)
Substrate binding. {ECO:0000250} 215..221 6/6 (100%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 82/452 (18%)
PTPc 917..1364 CDD:238006 82/451 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.