DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ptgs2 and cd

Sequence 1:NP_035328.2 Gene:Ptgs2 MGIID:97798 Length:604 Species:Mus musculus
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:562 Identity:115/563 (20%)
Similarity:192/563 (34%) Gaps:153/563 (27%)


Mouse   113 PPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP 177
            |.||..          |.:.|.....|..||....|. |..:..||.:::|..|:  .|......
  Fly   231 PRTYGA----------SMVPYRRMVSPDYADGIAAPR-VSHHGRLPPARQVSLKI--HRSSYETD 282

Mouse   178 QGSNMMFAFFAQHFTHQFFKT--------------------DH---------------------- 200
            ....:|.|.|.|...|....|                    .|                      
  Fly   283 SNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVDILPDDPYYKQYNISC 347

Mouse   201 ----KRGPGFTRGLGHGVDLNH---------IYGETLDRQHKLRLFKDGKLKYQVI--GGEVYP- 249
                :..|..|...|..:.||.         :||....||::||.|.:|.|:..|.  |.::.| 
  Fly   348 MNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMFVTDDGRQLLPI 412

Mouse   250 ---PTVKDTQVEMIY---------PPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDIL 302
               |.....:|:|..         .....|||          |:..:.:   :|.|.||.:...|
  Fly   413 SSNPADGCNRVQMTRLGKYCFESGDDRANENL----------LLTSMHL---LWARHHNYLARQL 464

Mouse   303 KQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKL---------------KFDPELL 352
            ::::|.|.||:|:|.:|.||..:...|...:::..|.|.:...               .:|||: 
  Fly   465 QEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDPEV- 528

Mouse   353 FNQQFQYQNRIASEF--NTLYHWHPLLPDTFNIE-----DQEYSFKQFLYNN-SILLEHGL---- 405
                   ...||:.|  ......|.|||..|||.     .:.....:.|:|. |:..|||:    
  Fly   529 -------DPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFSLWAEHGIDHAL 586

Mouse   406 --------TQFVESFTRQIAGRVAGGR---NVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLK 459
                    .|....|:.::..::..|.   .||:....:...:|.:.|:....|...:|:...|.
  Fly   587 MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLP 651

Mouse   460 PYTSFEELTGEKEMAA--ELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMG 522
            ...::||::...:.|.  .::.:|.....:::|...|.|.|...||||..:..:.:...|:..:|
  Fly   652 TVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLG 716

Mouse   523 NPICSPQYWKPSTFGGEVGFKI----INTASIQSLICNNVKG 560
            :     .:|.....|.:...|.    |...|:.::||.|..|
  Fly   717 D-----SHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDG 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ptgs2NP_035328.2 EGF 21..53 CDD:278437
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 115/563 (20%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 115/563 (20%)
peroxinectin_like 364..750 CDD:188655 88/412 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.