DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prkg2 and Pkg21D

Sequence 1:NP_032952.3 Gene:Prkg2 MGIID:108173 Length:762 Species:Mus musculus
Sequence 2:NP_477213.1 Gene:Pkg21D FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster

Alignment Length:788 Identity:349/789 (44%)
Similarity:489/789 (62%) Gaps:81/789 (10%)


Mouse    20 NLSN--EALR-------SKVLELERELRRKDAELQEREYHLKELREQLAKQTV-AIAELTEELQS 74
            ||:.  :|||       |::::|.||:.:..:.||:...:|...|.:.||:.: ::.|...|.:|
  Fly    17 NLTKDVQALREMVRSRESELVKLHREIHKLKSVLQQTTNNLNVTRNEKAKKKLYSLPEQCGEQES 81

Mouse    75 K-----------------------CIQLNKLQDVIHVQGGSPL------QASPDKVPLDVHRKTS 110
            :                       .:.|..|..:......||.      :..|..:|..:     
  Fly    82 RNQNPHLCSSCGMVLPTSPEFALEALSLGPLSPLASTSSASPSGRTSADEVRPKAMPAAI----- 141

Mouse   111 GLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQ 175
                      .|.|||||...::..    ..:|....:..||.|:|:.|.||:..|.|||.:|..
  Fly   142 ----------KKQGVSAESCVQSMQ----QSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDAS 192

Mouse   176 QIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC 240
            |::::|:.||.::...|.:||::||.|.|::|.|.|...|.|..|:|..:.....||||||||||
  Fly   193 QVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNC 257

Mouse   241 TRTASVKAITN-VKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEV 304
            |||||::.::. .:.|.|||.|||.||..|...|.|...||||||.||.||.|:.|.||.|.||:
  Fly   258 TRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLEL 322

Mouse   305 EYYDKGDYIIREGEEGSTFFILAKGKVKVTQS-TEGHDQPQLIKTLQKGEYFGEKALISDDVRSA 368
            |:|..|.||||:|..|.:||::::|.|:|||. |....:...::||.:|:||||:|||::|.|:|
  Fly   323 EFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTA 387

Mouse   369 NIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE 433
            ||||....|.||.:||::|.:.:|...||::...|        ||.|         ||:...:.|
  Fly   388 NIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYG--------DESR---------KLAMKQAQE 435

Mouse   434 MI--QLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENVA--FAMKCIRKKHIVDTKQ 494
            ..  :.||::.:........:||:::|||:||||||||||..:::..  ||:||::|:|||||||
  Fly   436 SCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQ 500

Mouse   495 QEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVAC 559
            :||::||:.|:....||||.:|||||:|.||||||||||:|||:|::|||||||::..::|.:.|
  Fly   501 EEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGC 565

Mouse   560 VTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILN 624
            |.:||:|||..||||||||||||:||..||:|:|||||||:||:..|||||||||||||||:|||
  Fly   566 VLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILN 630

Mouse   625 KGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQ 689
            ||||.:||:|:||||::|||.|.||||..|.|.|||||||||:.:.||:.|:|....||:||||.
  Fly   631 KGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRD 695

Mouse   690 NPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDE 754
            .|:||||....||.|||||:|..||:|:||.::.|..|..|.::.|.|..|||::|.:...||||
  Fly   696 VPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDE 760

Mouse   755 MSGWDKDF 762
            :||||.||
  Fly   761 LSGWDADF 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prkg2NP_032952.3 Crp 162..>285 CDD:223736 57/124 (46%)
cGMP-binding, high affinity, cAMP-binding, moderate affinity. {ECO:0000250|UniProtKB:Q13237} 168..283 53/116 (46%)
CAP_ED 168..273 CDD:237999 47/106 (44%)
cGMP-binding, high affinity, cAMP-binding, low affinity. {ECO:0000250|UniProtKB:Q13237} 286..416 58/131 (44%)
CAP_ED 286..401 CDD:237999 54/116 (47%)
PTZ00263 417..752 CDD:140289 188/339 (55%)
STKc_cGK 459..718 CDD:270724 168/261 (64%)
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 96/203 (47%)
CAP_ED 185..285 CDD:237999 46/100 (46%)
CAP_ED 304..419 CDD:237999 54/115 (47%)
Pkinase 457..717 CDD:278497 168/260 (65%)
STKc_cGK 463..724 CDD:270724 168/261 (64%)
S_TK_X 719..>760 CDD:214529 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4556
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1264
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127599
Panther 1 1.100 O PTHR24353
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.