DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pou2f3 and pdm2

Sequence 1:NP_035269.2 Gene:Pou2f3 MGIID:102565 Length:431 Species:Mus musculus
Sequence 2:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster

Alignment Length:442 Identity:177/443 (40%)
Similarity:213/443 (48%) Gaps:124/443 (28%)


Mouse    39 LDFNRQIKTEDLGDSLQQTLSHRPCHLSQGPTMMPGNQMSGDMASLHPLQQLVLVPGHLQS---- 99
            |...||.:      .|...|.:....|:..|..:...|....:||::|.|.:...|..:..    
  Fly   485 LSSKRQAR------ELDSELENEVLDLAPPPKRLAEEQEEEKVASVNPPQPVAFAPEEMHQALQL 543

Mouse   100 ----------------------VSQFLLSQTPPGQQGLQ-----PNLLSFPQQQSTLLLPQTGPG 137
                                  .:||||      |..||     ..|....|||....||.....
  Fly   544 QLHSYIEMVRQLAPEAFPNPNLATQFLL------QNSLQALAQFQALQQMKQQQREDPLPSYSTP 602

Mouse   138 LASQAVGRP-------------------------GLSGSSLEPHLDAPQHLP-----GPKHLPG- 171
            ||...:..|                         |:|.:.:.|:..:.|..|     .||...| 
  Fly   603 LAKSPLRSPSLSPVPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTSGL 667

Mouse   172 ---------PGGNDEPTDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEA 227
                     ....:|.|||||||:|||||||||||||||||||||||||||||||||||||||||
  Fly   668 TVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEA 732

Mouse   228 LNLSFKNMCKLKPLLEKWLNDAESSPS---------DPSASTPSSYPTLSEVFGRKRKKRTSIET 283
            |||||||||||||||:|||.||:|:.:         :...||.||.|  ..:.||:|||||||||
  Fly   733 LNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTP--ESILGRRRKKRTSIET 795

Mouse   284 NIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPVKPPIYNSR 348
            .:|.||||.|..|.||:|||||.::|:|:|:|||:|||||||||||||||        |.:   .
  Fly   796 TVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRIN--------PSL---D 849

Mouse   349 LVSPSGSLGPLS-----VPP-----VHSTMPGTVTSSCSPGNNSRPSSPGSG 390
            |.||:|:  |||     .||     .|..|.|...|.|.       ||..||
  Fly   850 LDSPTGT--PLSSHAFGYPPQALNMSHMQMEGGSGSFCG-------SSISSG 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pou2f3NP_035269.2 POU 176..250 CDD:197673 69/74 (93%)
Homeobox 277..330 CDD:278475 38/53 (72%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 61/64 (95%)
Homeobox 789..842 CDD:278475 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122106311
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005808
OrthoInspector 1 1.000 T130929
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11636
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.