DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pdgfra and drpr

Sequence 1:NP_001076785.1 Gene:Pdgfra MGIID:97530 Length:1089 Species:Mus musculus
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:262 Identity:54/263 (21%)
Similarity:85/263 (32%) Gaps:104/263 (40%)


Mouse   845 HDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFY-NK 908
            ||:|         |..| .|...|||                        |..||..::... |.
  Fly   840 HDTN---------PPSW-PPNHNFDN------------------------PVYGMQAETRLLPNN 870

Mouse   909 IKSGYRMAKPD-------------HATSEV--------YEIMVQCWNSEPEKRPSFYHLSEIVEN 952
            ::|  :|...|             :|:..|        ::::.:..|:: ...|..|:.|...|:
  Fly   871 MRS--KMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNAD-RTNPIVYNESLKEEH 932

Mouse   953 LL-----PGQYK---KSYEKI--------HLDFLK---SDHPAVARMRVDSDNAYIGVTYKNEED 998
            :.     ...||   |.|.||        |||:.:   |..|...||    ::|.:.:..     
  Fly   933 VYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRM----NDAMLNINQ----- 988

Mouse   999 KLKDWEGGLDEQRLSADSGYII----PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF 1059
                     ||::.|......:    |||..:|.|:.|.....|.:....|..|.    |||..|
  Fly   989 ---------DEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASP----SSSPKF 1040

Mouse  1060 IK 1061
            :|
  Fly  1041 LK 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PdgfraNP_001076785.1 IG_like 221..309 CDD:214653
Ig1_PDGFR-alphabeta 228..311 CDD:143269
Ig4_PDGFR-alpha 313..413 CDD:143267
IG 334..410 CDD:214652
Ig_TrkABC_d4 416..497 CDD:143173
PTKc_PDGFR_alpha 555..956 CDD:173653 23/138 (17%)
Pkinase_Tyr 593..953 CDD:285015 23/130 (18%)
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.