DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DUSP3 and CG10089

Sequence 1:NP_004081.1 Gene:DUSP3 HGNCID:3069 Length:185 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster

Alignment Length:151 Identity:53/152 (35%)
Similarity:83/152 (55%) Gaps:13/152 (9%)


Human    32 EVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEF 96
            :|.|.:||||...::|..:|::..|:|::       .:| ::......|.  .||.:.|:||.:.
  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHII-------AIH-DSPRRLLPDK--HYLCVMASDTPDQ 61

Human    97 NLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREI- 160
            |||.||....||| .|...:.|.||:||..|.|||.|:.:||:|....::.|.||.:||..|.: 
  Fly    62 NLSQYFSVCNDFI-HAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVA 125

Human   161 GPNDGFLAQLCQLND-RLAKE 180
            .||.||.:||.:... :|::|
  Fly   126 NPNAGFQSQLQEFEQFKLSEE 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DUSP3NP_004081.1 DSPc 29..174 CDD:238073 51/143 (36%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 51/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.