DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARID3A and osa

Sequence 1:NP_005215.1 Gene:ARID3A HGNCID:3031 Length:593 Species:Homo sapiens
Sequence 2:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster

Alignment Length:589 Identity:143/590 (24%)
Similarity:201/590 (34%) Gaps:184/590 (31%)


Human    28 PPDPPAAPPGRARAAPDEDREPESARMQRAQMAALAAMRAAAAGLGHPASPGGSEDGPPG--SEE 90
            ||.....|.|.....|.....|:|..:|..|..            |..|| ||.|.|.|.  |::
  Fly   809 PPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQ------------GQGAS-GGPESGGPEHISQD 860

Human    91 EDAAREGTPGSPGRG------REGPGEEHFEDMASDEDMKPKWEEEEMEEDLGED------EEEE 143
            ...:..|..|:.|..      ..||      |..|.:::..:..........|||      :..:
  Fly   861 NGISSSGPTGAAGMHAVTSVVTTGP------DGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRK 919

Human   144 EEDYEDEEEEEDEEGLGPP-------------GPA---SLGTTALFPRKAQPPQAFRGDGVPRVL 192
            .:.|       .:..|.||             ||.   .:.:...:||.|..||.|.        
  Fly   920 NDPY-------SQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFN-------- 969

Human   193 GGQERPGPGPAHPGGAAHVAPQLQPPDHGDWT---YEEQFKQLYELDGDPKRKEFLDDLFSFMQK 254
                             || |..|.|.....|   ..:...:|||:|.:|.|:.:||.|.:||::
  Fly   970 -----------------HV-PVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEE 1016

Human   255 RGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYM 319
            |.||:...|.::||.|||:.||:.|.|:||.|||...|.|::|...|.:..| :|||:|||..|.
  Fly  1017 RRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYT 1080

Human   320 KYLYPYECE-KRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLA 383
            |.|..:||. .||..:|..:...:::    |.::....:....||||.|       |...:....
  Fly  1081 KNLLTFECHFDRGDIDPLPIIQQVEA----GSKKKTAKAASVPSPGGGH-------LDAGTTNST 1134

Human   384 ASTNGSSITPAPKIKKEEDSAIPITVPGRLP-VSLAGHPVVAAQAAAVQAAAAQA--AVAAQAAA 445
            .|:|.....|||              ||..| .::.|:|.....:....|:..|.  |.|.|   
  Fly  1135 GSSNSQDSFPAP--------------PGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQ--- 1182

Human   446 LEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNL 510
                                        |||...||              |.|.......:||  
  Fly  1183 ----------------------------MQRPPSQN--------------NPQTPHPGAAAAV-- 1203

Human   511 TGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQA 575
              ..|.| ||:|                   .|...|...|||.|..:....|:|...|.:.|.|
  Fly  1204 --AAGDN-ISVS-------------------NPFEDPIAAGGGPGSGTGPGPGQGPGPGAASGGA 1246

Human   576 GPAG 579
            |..|
  Fly  1247 GAVG 1250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARID3ANP_005215.1 Acidic 119..156 5/43 (12%)
BRIGHT 239..331 CDD:128777 42/93 (45%)
Important for nuclear localization. {ECO:0000250} 445..488 5/43 (12%)
Homodimerization 490..513 4/23 (17%)
Important for cytoplasmic localization. {ECO:0000250} 537..557 6/20 (30%)
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 41/92 (45%)
DUF3518 2191..2451 CDD:288854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
21.990

Return to query results.
Submit another query.