DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: myo-2 and zip

Sequence 1:NP_510092.2 Gene:myo-2 WormBaseID:WBGene00003514 Length:1947 Species:Caenorhabditis elegans
Sequence 2:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster

Alignment Length:1990 Identity:710/1991 (36%)
Similarity:1121/1991 (56%) Gaps:83/1991 (4%)


 Worm     5 NDPGWKYLRRSREEMLQDQSRA-YDSKKNVWIPDSEDGYIEGVITKTAGDNVTVSIGQ-GAEKTV 67
            |||..|||...|.:.....::| :..|:.||:|....|::...|.:..||.|.|.:.: |....:
  Fly    53 NDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMI 117

 Worm    68 KKDVVQEMNPPKFEKTEDMSNLTFLNDASVLYNLKARYAAMLIYTYSGLFCVVINPYKRLPIYTD 132
            .:|.:|:||||||:|.|||:.||.||:||||:|:|.||.:.||||||||||||:||||:|||||:
  Fly   118 LRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTE 182

 Worm   133 SVARMFMGKRRTEMPPHLFAVSDEAYRNMLQNHENQSMLITGESGAGKTENTKKVISYFAAVGAA 197
            .:...:.|.:|.|:|||:||::|.||||||.:.|:||:|.||||||||||||||||.:.|.|.|:
  Fly   183 KIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAAS 247

 Worm   198 QQETFGA--------------------KKAA---------------TEEDKNKKKVTLEDQIVQT 227
            :.:..||                    |..|               .|.:.|.::..||.|::|.
  Fly   248 KPKGSGAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQA 312

 Worm   228 NPVLEAFGNAKTVRNNNSSRFGKFIRIHFSKQGRVASCDIEHYLLEKSRVIRQAPGERCYHIFYQ 292
            ||:||||||||||:|:|||||||||||:|...|.::..:||.|||||||.||||..||.:|||||
  Fly   313 NPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQ 377

 Worm   293 VFSDYLPNLKKDLLLNKPVKDYWFIAQAELIIDGINDKEEHQLTDEAFDILKFTPTEKMECYRLV 357
            :.:...|..::..:|: .||.|.|::...|.:.|::|..|.|.|.::.:|:..|..:....:|:|
  Fly   378 LLAGATPEQREKFILD-DVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIV 441

 Worm   358 AAMMHMGNMKFKQRPREEQAE-PDGTDDAERAAKCFGIDSEEFLKALTRPRVKVGNEWVNKGQNI 421
            :|::..|:|||:|....:||. ||.| .|::.|...|:...:..:|...||:|||.::|.|.|..
  Fly   442 SAVLLFGSMKFRQERNNDQATLPDNT-VAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVTKAQTK 505

 Worm   422 EQVNWAVGAMAKGLYSRIFNWLVKKCNQTLDQKGISRDHFIGVLDIAGFEIFDFNSFEQLWINFV 486
            |||.:||.|:||..|.|:|.|||.:.|::||:.......|||:||:||||||:.||||||.||:.
  Fly   506 EQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYT 570

 Worm   487 NEKLQQFFNHHMFVLEQEEYAREGIQWTFIDFGLDLQACIELIEKPLGIIAMLDEECIVPKATDL 551
            ||||||.|||.||:||||||.||||:|.|||||||||..|:||:||.||:|:|||||..|||||.
  Fly   571 NEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFPKATDK 635

 Worm   552 TLAQKLIDQHLGKHPNFEKPKPPKGKQAEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVTVMK 616
            |...||:..| ..||.|.|    ...:..|.||:.||||.|.|:...||.||.||||:.:|::::
  Fly   636 TFVDKLVSAH-SMHPKFMK----TDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQ 695

 Worm   617 ASKEHALIVEVWQDYTTQEEAAAAAAKGTAGAKKKGKSGSFMTVSMLYRESLNKLMTMLHSTHPH 681
            .|:: ..:|.:|:|......|..|......||:.  :.|.|.|||.||:|.|.|||..|.:|:|:
  Fly   696 GSQD-PFVVNIWKDAEIVGMAQQALTDTQFGART--RKGMFRTVSHLYKEQLAKLMDTLRNTNPN 757

 Worm   682 FIRCIIPNEKKASGVIDAGLVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYALLAADESIIG 746
            |:||||||.:|.:|.|||.|||:||.||||||||||||:|||||....:|.|||.||..:....|
  Fly   758 FVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKG 822

 Worm   747 KTDAKKGSALMLARLVKEKKLEEENFRVGLTKVFFKAGIVAHLEDLRDQSLAQLITGLQAQIRWY 811
            ..|.||....|:..|    :|:...:|||.:|:||:||::||||:.||..::.||...||..|.:
  Fly   823 FMDGKKACEKMIQAL----ELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGF 883

 Worm   812 YQTIERKRRVEKITALKIIQRNIRSWAELRTWVWFKLYGKVKPLVNSGKIEAQYEKLQETVATLK 876
            ......::|::::.|::|||||..::.:||.|.|::||.|||||:   ::..|.|||        
  Fly   884 LARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLL---EVTKQEEKL-------- 937

 Worm   877 DTVVQEEEKKRQLQEGAERLNKETAD--------------LLAQLEASKGSTREVEERMTAMNEQ 927
               ||:|::.:|::|..:.|.|.|.:              |..||:|......|.||..:.:..:
  Fly   938 ---VQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMAR 999

 Worm   928 KVALEGKLADASKKLEVEEARAVEINKQKKLVEAECADLKKNCQDVDLSLRKVEAEKNAKEHQIR 992
            |..||..:.:...::|.||.|.:.:..:||.:|....||::..::.:.:.:|::.||...:.:|:
  Fly  1000 KQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIK 1064

 Worm   993 ALQDEMRQQDENISKLNKERKNQEEQNKKLTEDLQAAEEQNLAANKLKAKLMQSLEDSEQTMERE 1057
            ..::::...|:...||.||:|..||:...|::.|...||:.....|||||...::.:.|:.:.::
  Fly  1065 KYEEDLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKD 1129

 Worm  1058 KRNRADMDKNKRKAEGELKIAQETLEELNKSKSDAENALRRKETELHTLGMKLEDEQAAVAKLQK 1122
            ::.|.:.|::|||.|.|:...:|.|.|......:.:..|.::|.||....:::::|.|..|..||
  Fly  1130 QQQRQESDRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQK 1194

 Worm  1123 GIQQDEARVKDLHDQLADEKDARQRADRSRADQQAEYDELTEQLEDQARATAAQIELGKKKDAEL 1187
            ..::.|:::.::.:.|..||.||.:|::.|.|...|.:.|..:|.|....||||.||..|::.||
  Fly  1195 AQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQEL 1259

 Worm  1188 TKLRRDLEESGLKFGEQLTVLKKKGSDAIQELSDQIEQLQKQKGRIEKEKGHMQREFDESSAALD 1252
            ..|::.|||..:.....|..::.|.|..:..::||:|.|:|.|..:||.||.::.|..:.:..|.
  Fly  1260 ATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELR 1324

 Worm  1253 QEAKLRADQERIAKGYEVRLLELRLKADEQSRQLQDFVSSKGRLNSENSDLARQVEELEAKIQAA 1317
            .....|.:.:|..|..|.::.||::|..|..|...:......:|..|..::..|:||.|.|..||
  Fly  1325 SVNSSRQENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAA 1389

 Worm  1318 NRLKLQFSNELDHAKRQAEEESRERQNLSNLSKNLARELEQLKESIEDEVAGKNEASRQLSKASV 1382
            .:......::|..|::..|||:|::..||:..:.:..|.|.|:|.:|::...|....|:|::.:.
  Fly  1390 VKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTT 1454

 Worm  1383 ELDQWRTKFETEGLIGADEFDEVKKRQNQKTSEIQDALDACNAKIVALENARSRLTAEADANRLE 1447
            ::.:.:.|.|.:..: |.|.:|.|||.|:....::..:....|:...|:.::.::.:|.:...:|
  Fly  1455 QMQEIKKKAEEDADL-AKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIE 1518

 Worm  1448 AEHHAQAVSSLEKKQKAFDKVIDEWKKKVDDLYLELDGAQRDARQLSGEAHKLRGQHDTLADQVE 1512
            .|.....|..||||||.|||::.|.|...:.:..|.|.|:|:||:...:...:..:.|...|::|
  Fly  1519 LEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIE 1583

 Worm  1513 GLRRENKSLSDETRDLTESLSEGGRATHALSKNLRRLEMEKEELQRGLDEAEAALESEESKALRC 1577
            .|..:.|:|.:|..||..:.....:..|.|.|..|.||.:..||:...:|.|..|:..|...||.
  Fly  1584 DLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRL 1648

 Worm  1578 QIEVSQIRAEIEKRIAEKEEEFENHRKVHQQTIDSIQATLDSETKAKSELFRVKKKLEADINELE 1642
            ::.:..:|::.|:.:..|||..|..|:...:.:..::..||.|.|.::.....|||||.|:.|:|
  Fly  1649 EVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIE 1713

 Worm  1643 IALDHANKANEDAQKNIRRYLDQIRELQQTVDEEQKRREEFREHLLAAERKLAVAKQEQEELIVK 1707
            ..::..||..|||.|:.::...|:::..:..:|.:..:||.:.....||||:...:.|..:|...
  Fly  1714 TTMEMHNKVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTED 1778

 Worm  1708 LEALERARRVVESSVKE-HQEHNNELNSQNVALAAAKSQLDNEIALLNSDIAEAHTELSASEDRG 1771
            |.:.|||||..|:...| .:|..|..|..:: :...|.:|:..||.|..::.|..:......||.
  Fly  1779 LASSERARRAAETERDELAEEIANNANKGSL-MIDEKRRLEARIATLEEELEEEQSNSEVLLDRS 1842

 Worm  1772 RRAASDAAKLAEDLRHEQEQSQQLERFKKQLESAVKDLQERADAAEAAVMKGGAKAIQKAEQRLK 1836
            |:|.....:|..:|.:|:..||:.|..:..||...|:|:.:....|.|........|...|.::.
  Fly  1843 RKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIA 1907

 Worm  1837 AFQSDLETESRRAGEASKTLARADRKVREFEFQVAEDKKNYDKLQELVEKLTAKLKLQKKQLEEA 1901
            ..:..||.|.:......|...:.|:|::|....:.:::::.|:.:|.::||.:::||.|:.|:|.
  Fly  1908 NLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDET 1972

 Worm  1902 EEQANSHLSKYRTVQLSLETAEERADSAEQCLVRIRSRTR 1941
            ||:.....::.|..|...|...|..::..:.:..::::.|
  Fly  1973 EEELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLR 2012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
myo-2NP_510092.2 Myosin_N 31..68 CDD:280832 10/38 (26%)
Myosin_head 83..782 CDD:278492 356/735 (48%)
MYSc_class_II 95..782 CDD:276951 349/723 (48%)
Myosin_tail_1 876..1939 CDD:279860 290/1078 (27%)
zipNP_523860.2 Myosin_N 80..117 CDD:280832 10/37 (27%)
Myosin_head 133..854 CDD:278492 356/735 (48%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 349/723 (48%)
Myosin_tail_1 931..2011 CDD:279860 294/1093 (27%)
Prefoldin 1431..1515 CDD:298833 18/85 (21%)
FAM76 <1847..1926 CDD:292665 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126577
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.