DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: syd-2 and zip

Sequence 1:NP_509768.1 Gene:syd-2 WormBaseID:WBGene00006364 Length:1139 Species:Caenorhabditis elegans
Sequence 2:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster

Alignment Length:1253 Identity:250/1254 (20%)
Similarity:483/1254 (39%) Gaps:304/1254 (24%)


 Worm    40 MMNMLEDRDKL---QEQLENYKVQLENAGLRTKEVEKERDMMKRQFEVHTQNLPQELQTMTRELC 101
            ::.:.:..:||   :::|:..:.:|:.....|:|.|::    .:|..|....|.::||... |||
  Fly   927 LLEVTKQEEKLVQKEDELKQVREKLDTLAKNTQEYERK----YQQALVEKTTLAEQLQAEI-ELC 986

 Worm   102 LLKEQLLEKDEEIVELKAERNNTRLLLEHLECLV-SRHERSLRMTVMKRQAQ-NHAGVSSEVEVL 164
                  .|.:|....|.|.:.....:::.||..: ...||.|.:...|::.: |...:..::|..
  Fly   987 ------AEAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEE 1045

 Worm   165 KALKSLFEHHKA-LDEKVRERLRVAMERVATLEEELSTKGDENSS-LKARIATYAAEAEEAMASN 227
            :|.:...:..|. ||.|:::           .||:|:...|:|.. ||.:               
  Fly  1046 EAARQKLQLEKVQLDAKIKK-----------YEEDLALTDDQNQKLLKEK--------------- 1084

 Worm   228 APINGSISSESANRLIEMQEALERMKTELANSLKQSTEITTRNAELEDQLTEDAREKHAAQESIV 292
                 .:..|.||.|.:.....|.....|| .||...|.|.  :|||::|.:|.:::..:..|..
  Fly  1085 -----KLLEERANDLSQTLAEEEEKAKHLA-KLKAKHEATI--SELEERLHKDQQQRQESDRSKR 1141

 Worm   293 RLKNQICELDAQRTDQETRITTFESRFLTAQRESTCIRDLNDKLEHQLANKDAAVRLN---EEKV 354
            :::.::.:|..|..::..::...:::.  |:||....:.|. :::.:.|.|..|.:..   |.::
  Fly  1142 KIETEVADLKEQLNERRVQVDEMQAQL--AKREEELTQTLL-RIDEESATKATAQKAQRELESQL 1203

 Worm   355 HSLQERLELAEKQLAQSLKKAESLPSVEAELQQRMEAL----------TAAEQKSVSAEERIQRL 409
            ..:||.|| |||   .:..|||   .|..:|.:.:|||          |||:|:..|..|     
  Fly  1204 AEIQEDLE-AEK---AARAKAE---KVRRDLSEELEALKNELLDSLDTTAAQQELRSKRE----- 1256

 Worm   410 DRNIQELSAELERAVQRERMNEE---------HSQRLSSTVDKLLSESNDRLQLHLKERMQALDD 465
                ||| |.|:::::.|.:|.|         |||.|:|..|:|  |:..:.:..|::....|:.
  Fly  1257 ----QEL-ATLKKSLEEETVNHEGVLADMRHKHSQELNSINDQL--ENLRKAKTVLEKAKGTLEA 1314

 Worm   466 KNR-LTQQLDGTKKIYDQAERIKDRLQRDNESLRQEIEALRQQLYNARTAQFQSRMHAIPFTHAQ 529
            :|. |..:|    :..:.:.:..||.::..||...|::....::..|| ::.|.:...:. ..|:
  Fly  1315 ENADLATEL----RSVNSSRQENDRRRKQAESQIAELQVKLAEIERAR-SELQEKCTKLQ-QEAE 1373

 Worm   530 NIVQQ----QPQASIAQQSAYQMYKQQPAQQYQTVGMRRPNKGRISALQDDPNKVQTLNEQ--EW 588
            ||..|    :.:||.|.:||..|..|....|.......|...|..|.|:...::.:.|.||  |.
  Fly  1374 NITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEED 1438

 Worm   589 DRLQQ------AHVLANVQQAFSSSPSLADV------GQSTLPRPNTAVQHQ------QDDMMNS 635
            |..::      |.|...:|:....:...||:      |:..|.:...|::.|      |:|.:: 
  Fly  1439 DEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEALERQVKELIAQNDRLD- 1502

 Worm   636 GMGMPSGMQGGMQGGMGGGQDAQMLASMLQD---RLDAINTEI-----------RLIQQEKHHAE 686
                               :..:.:.|.|:|   .|:|..|::           :::.:||..:|
  Fly  1503 -------------------KSKKKIQSELEDATIELEAQRTKVLELEKKQKNFDKILAEEKAISE 1548

 Worm   687 RVAEQLERSSREFYDDQ----GISTRSSPRASPQLDNMRQHKYNTLPANVSGDRRYDIYGNPQFV 747
            ::|::.:.:.||..:.:    .:| |....|..::::: ::|..||      ....|...|.|..
  Fly  1549 QIAQERDTAEREAREKETKVLSVS-RELDEAFDKIEDL-ENKRKTL------QNELDDLANTQGT 1605

 Worm   748 DDRMVRDLDYEPRRGYNQFDEM------------------------------QYERDRMSPASSV 782
            .|:.|.:|:...|...:|..|:                              |:|||.::.....
  Fly  1606 ADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGA 1670

 Worm   783 ASSTDGV---------------------LGGKKKRSNSSSGLKTLGRFFNK-KKNSSSDLFKRNG 825
            .....|:                     :..|||.......::|.....|| |:::.....|...
  Fly  1671 EEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQA 1735

 Worm   826 DYSDGEQSGTEGNQKADYDRRKKKKHELLEEAMKARTPFALWNGPTVVAWLELWVGMPAWYVAAC 890
            ...|..:...|.....:..:...|:.|...:|::|..             |:|...:.:...|..
  Fly  1736 QVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEV-------------LQLTEDLASSERARR 1787

 Worm   891 RANVKSGAIMSALSDQEIQKEIGISNPLHRLKLRLA-----IQEMVSLTSPSAPRTARLTLAFGD 950
            .|..:...:...:::...:..:.|... .||:.|:|     ::|..|.:.....|:.:..|....
  Fly  1788 AAETERDELAEEIANNANKGSLMIDEK-RRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQ 1851

 Worm   951 MNHEYIGNDWLPCLGLAQYRSAFMECLLDARMLEHLSKRDLRTHLRMVDTFHRTSLQYGIMCLKK 1015
            :..|           ||..:|...:......:||..:| :|:..|..::|..||.::..|..|  
  Fly  1852 LTTE-----------LANEKSNSQKNENGRALLERQNK-ELKAKLAEIETAQRTKVKATIATL-- 1902

 Worm  1016 VNYDKKVLADRRKACDNINTDLLVW--SNERVQRWVEEIGLGV-FSRNLVD----------SGIH 1067
                :..:|:..:..:|...:.|:.  :|.::.:.::|:.:.: ..|..||          |.|.
  Fly  1903 ----EAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIK 1963

 Worm  1068 GALIALDETFDASAFAYALQ----------------IGSQDVPNRQL--LEKKF-----IGLVND 1109
            .....||||.:      .||                |.||:..||::  |:.|.     |||.:.
  Fly  1964 LLKRNLDETEE------ELQKEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRRTGGIGLSSS 2022

 Worm  1110 HRQQSDPHPRSGSSRKND 1127
            ....:....|:|.....|
  Fly  2023 RLTGTPSSKRAGGGGGGD 2040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
syd-2NP_509768.1 BAR <323..474 CDD:299863 49/174 (28%)
Ferritin_like <667..>728 CDD:294190 14/76 (18%)
SAM_liprin-alpha1,2,3,4_repeat1 864..934 CDD:188961 11/75 (15%)
SAM 864..930 CDD:197735 10/71 (14%)
SAM_liprin-alpha1,2,3,4_repeat2 951..1016 CDD:188964 14/65 (22%)
SAM 959..1015 CDD:197735 13/56 (23%)
SAM_liprin-alpha1,2,3,4_repeat3 1036..1107 CDD:188967 24/107 (22%)
SAM 1039..1109 CDD:197735 23/106 (22%)
zipNP_523860.2 Myosin_N 80..117 CDD:280832
Myosin_head 133..854 CDD:278492
MYSc_Myh2_insects_mollusks 145..854 CDD:276876
Myosin_tail_1 931..2011 CDD:279860 244/1219 (20%)
Prefoldin 1431..1515 CDD:298833 19/104 (18%)
FAM76 <1847..1926 CDD:292665 18/97 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.