DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: calu-1 and CG31650

Sequence 1:NP_001024806.1 Gene:calu-1 WormBaseID:WBGene00019760 Length:314 Species:Caenorhabditis elegans
Sequence 2:NP_001162879.1 Gene:CG31650 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster

Alignment Length:332 Identity:105/333 (32%)
Similarity:171/333 (51%) Gaps:38/333 (11%)


 Worm     4 LLFVGLLAAT-------ALASHH------SSDPSKDG--------EHFKGKEHDKKYDHEQFLGK 47
            |..|.||||.       |:|:.|      |.:..|||        .|.:..||:.::|||..:|.
  Fly    12 LCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNVEFDHEAIIGN 76

 Worm    48 -DTAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAE 111
             ..|.|||.|:|::||.:|..|:..||.:.|.||:.:|||..|....|:....:....::  :.:
  Fly    77 TKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFE--EID 139

 Worm   112 KIVDGKIKWEDYREMVYGSADGAGQELSPEY------AKMIARDEKRWAVADYDSNGALDRTEYG 170
            :..|.:|.|::|.:..|...|...::.:.:|      .|||.:|::.:..||.:.:|.|...|:.
  Fly   140 QDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFV 204

 Worm   171 CFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFK 235
            .|.:||:...|..:::..|:.|.|.:.||.::..|::||.....|        .:|:.:|:|.|.
  Fly   205 LFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHD--------KEWLITEKERFD 261

 Worm   236 EHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQAT 300
            :..|.:|||.|..:|:..||:|.....|..|..||....|::.|.:|:..||:.:|||||||:||
  Fly   262 KDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEAT 326

 Worm   301 DYGEQLQ 307
            |||:.||
  Fly   327 DYGDHLQ 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
calu-1NP_001024806.1 EF-hand_7 150..207 CDD:290234 15/57 (26%)
EFh 191..256 CDD:238008 20/65 (31%)
EF-hand_7 231..291 CDD:290234 20/60 (33%)
EFh 231..290 CDD:298682 20/59 (34%)
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 14/55 (25%)
EFh 100..153 CDD:298682 14/55 (25%)
EF-hand_7 184..241 CDD:290234 15/57 (26%)
EFh 184..241 CDD:298682 15/57 (26%)
EFh 228..281 CDD:298682 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D372250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.