DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hpx-2 and Spf45

Sequence 1:NP_506432.1 Gene:hpx-2 WormBaseID:WBGene00008627 Length:718 Species:Caenorhabditis elegans
Sequence 2:NP_001036426.1 Gene:Spf45 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster

Alignment Length:188 Identity:41/189 (22%)
Similarity:68/189 (36%) Gaps:65/189 (34%)


 Worm   133 RSKRQANRRCSSPPINCNNRFHTSIRS--ITGLC-------NNRQNSDLGNSVSPLRRILGAASY 188
            ||||.|:     |.:.|.....|.:..  |:|..       .||.:.|:.:...|.|        
  Fly    48 RSKRLAD-----PEVTCFAPITTVVSKPLISGKALPSILERINRGDWDVADEYDPQR-------- 99

 Worm   189 ADGLGRIRTRSVNGGELPSARLISNRIHDDR---------------NNQVFSPSINHLHMIIGQF 238
            .:...:::.:| ||.:...|.:......||:               .::|.:|::.    :.|  
  Fly   100 PNEYEKLKEKS-NGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLK----LSG-- 157

 Worm   239 IAH----DVVFMPSS--VARDGGA------------LD--CSACNS-PQRVSPNCAPI 275
            ..|    |.:::||.  ||:.|||            :|  |.|.|: |...|...|.|
  Fly   158 FGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSIDSGCEATNTMPYSASSVAAKI 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hpx-2NP_506432.1 An_peroxidase 158..686 CDD:281139 33/164 (20%)
peroxinectin_like 304..684 CDD:188655
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 3/8 (38%)
RRM_UHM_SPF45 307..402 CDD:241091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.