DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mug2 and Tep2

Sequence 1:XP_006505762.1 Gene:Mug2 MGIID:99836 Length:1490 Species:Mus musculus
Sequence 2:NP_523506.1 Gene:Tep2 FlyBaseID:FBgn0041182 Length:1420 Species:Drosophila melanogaster

Alignment Length:1566 Identity:431/1567 (28%)
Similarity:703/1567 (45%) Gaps:273/1567 (17%)


Mouse    11 LFSVLLAFLPSASSLNGDSKYMVLV-------PSQLYTETPEKICLHLYHLNETVTVTASLVSQT 68
            ::||:     ...:|..:|||.|:|       |||:      |:.|:....|||..:....:|. 
  Fly    22 IYSVV-----GPGTLRSNSKYNVVVSVHKADGPSQI------KVSLNGPSYNETKQIELPPMST- 74

Mouse    69 GRRNLFDELVVDKDLFQCVSFIIPTLNSPDEEEFLYVDIKGPTHEFSKRNAVL-VKNKESVVFVQ 132
                            |.|.|.:|.|.:.:..    :..:|.:....|.:..| ..:|:..||||
  Fly    75 ----------------QNVEFEVPKLATGNYN----LSAEGVSGVVFKNSTKLNYADKKPSVFVQ 119

Mouse   133 TDKPVYKPGQSVKFRVVSMDKTLRPLNELLPLA-YIEDPKKNRIMQWRDIKTENGLKQMSFSLAA 196
            |||..|||...|:||::.:|:..||.....|:: .|.|..:|||.|..|:|...|:......|:.
  Fly   120 TDKATYKPADLVQFRILFLDENTRPAKIEKPISVIIIDGAQNRIKQLSDVKLTKGVFSGELQLSE 184

Mouse   197 EPIQGPYKIVVHKQSGVKEEHSFTVMEFVLPRFNVDLKVPNAISVNDEVLQVTVCGKYTYGKPVP 261
            :|:.|.:||.|......:|..||.|.::|||:|.|.:..|.|:.:.|:|::.|:..||||||||.
  Fly   185 QPVLGTWKISVSVDGDNRETKSFEVDKYVLPKFEVIVDTPKAVVIADKVIKATIRAKYTYGKPVK 249

Mouse   262 GQVKISI------CHETEAGCKEVNSKLDNNGCSTQEVNITELQSKKRNY--EVQLFHVNATVTE 318
            |:..:|:      ..:..|...:....:|.:|....|.:|.. .:::..|  .::||   |.|||
  Fly   250 GKATVSMERSYGYFGDLNANGNKQEKTIDVDGKGHVEFDIIH-WAQRGQYLPPIKLF---AVVTE 310

Mouse   319 EGTGLEFNGYGTTKIERITNKLIFLKADSHFRHGIPFFVKVRLVDIKGDPIPNERVFIKAQVLGY 383
            |.||.:.|...|..:.:....:...:...||.....|..:|.:.::.|.|:.|....:|   :|:
  Fly   311 ELTGNKQNATATVVLHQQRYSIEPYERPEHFEANKSFIYQVVVKNVDGSPVTNSAKNVK---IGF 372

Mouse   384 TSA----------------TTTDQHGLAKFSIDTAGFSGSSLHIKVNHKGKDSCYFFYCMEERYA 432
            ..:                ...:::|:|.|:              |.....||.|:     ..:|
  Fly   373 DKSYSYFHEPSPKTRINFEAPVNENGIATFN--------------VRLPDSDSRYY-----RIFA 418

Mouse   433 SAEHVAYAVYSLSK-SYIYLVKETSSILPCNQIHT------VQAHFILKGDLGVLKEL-VFYYLV 489
            |.:.....:.|:|| ....:.:|...|    |::|      .|..|    |:..:::| .|.|.:
  Fly   419 SFDGSENTIGSISKFEPTPMSREPLKI----QVNTKKPRLGEQVSF----DVVSIEDLPYFVYTI 475

Mouse   490 MAQGSIIQT-------GNHTHQVEPGEAPVKGNFDLEIPVEFSMAPMAKMLIYTILPDGEVIADS 547
            :|:|::|.:       |..|:.|             :....|||.|.|.:.:|.:: :.::..:.
  Fly   476 VARGNVILSDYVDVPDGQKTYTV-------------KFTPTFSMVPKATIYVYYVV-NNDLQFEE 526

Mouse   548 VNFEIEKCLRNKVDLSFSSSQSLPASQTRLQVTASPQSLCGLRAVDQSVLLLKPEDELSPSWIYN 612
            ...:.||...|.:|:| :.:.:.|:.:.:|::.....|..||..|||||||||..::||...|:|
  Fly   527 KTIDFEKEFSNSIDVS-APTNAKPSEEVKLRIKTDADSFVGLLGVDQSVLLLKSGNDLSQDDIFN 590

Mouse   613 -----------------LPGMQHNKFIPSSSLSEDREDCILYSSWVAE--KHTDWVPHGREKDVY 658
                             .|| |.:..:..::.:.......|..|:|.|  :| .|:...|    |
  Fly   591 SLNIYQTSTPWMNGYGRYPG-QTSGLVTLTNANYPYNTGPLVMSYVFEGSRH-PWITRPR----Y 649

Mouse   659 RYVEDMDLKAFTNLKIKLPKICFDSAPMSGPRGKFDLAFSSEVSGTLQKGSSKRPQPEEPPREDP 723
            |.....|                     ||.|..|       :|.:|...:.|....::.|:.  
  Fly   650 RVGIRGD---------------------SGDRISF-------LSQSLNDRNLKEILLKQTPQR-- 684

Mouse   724 PPKDPLAETIRKYFPETWVWDIVTVNSTGVAEVEMT----VPDTITEWKAGALCLSNDTGLGLS- 783
                   .||||.|||||.::       .|.|.|.|    :|||||.|......|:..:|:.|: 
  Fly   685 -------TTIRKEFPETWFFE-------NVGEEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTK 735

Mouse   784 SVVPLQAFQPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMRMSVQLEASP---DFT-------- 837
            :...::.||||||..:|||||.|||...:...:.|||..::...|.::.|.   :||        
  Fly   736 NPSKIRVFQPFFVSTNLPYSVKRGEVIAIPVVIFNYLDKTLDADVVMDNSDQEYEFTEATNEVLE 800

Mouse   838 -AVPVGDDHDSYCLSANGRHTSSWLVTPKSLGNVNFSVSVEAQQSSEPCGSEVATVPETGRKDTV 901
             |:..........:.||...:.|:::.||::|.....::              ||....|  |.:
  Fly   801 KAIDEVRRVKRVTIPANSGKSVSFMIRPKNVGFTTLKIT--------------ATSALAG--DAI 849

Mouse   902 VKVLIVEPEGI---KQEHTFNSLFCASDAEISEKMSLVLPPTVVKDSARAHFSVMGDILSSAIKN 963
            .:.|.|||||:   :....|.:|  ....|:|:.:...:|..||..|....|||:||:|...::|
  Fly   850 HQKLKVEPEGVTLFENRAVFINL--KDQPEMSQSLDADIPNEVVPQSEFIEFSVVGDLLGPTLQN 912

Mouse   964 TQNLLHMPYGCGEQNMVLFAPNIYVLKYLDKTQQLTQKIKTKALGFLRAGYQRELNYKHKDGSYS 1028
            ..||:.|||||||||||.|.|||.|||||:.|.:....:::||..||..||||||.|||.|||||
  Fly   913 LDNLVRMPYGCGEQNMVNFVPNILVLKYLEVTGRKLPSVESKARKFLEIGYQRELTYKHDDGSYS 977

Mouse  1029 AFGDQNGEREGNTWLTAFVLKSFAQARAFIFIDESHITHAFTWLSQQQKDNGCFRSSGSLFHNDI 1093
            |||  ..:..|:|||||:|::||.||..:..||...||....:|..:||::|.|...|.||.|  
  Fly   978 AFG--KSDASGSTWLTAYVMRSFHQAGTYTDIDPKVITAGLDFLVSKQKESGEFPEVGKLFDN-- 1038

Mouse  1094 KGGVDDEMTLSAYITMALLESSLPARHPVVSKALSCLESSWKTI-EQGRNANFVYTKALMAYAFA 1157
              ...:.:.|::::.:|..|:     |.::.|..|.::.:.:.: |:....:..|:.|:.|.|..
  Fly  1039 --ANQNPLALTSFVLLAFFEN-----HELIPKYQSAIKKAVRYVAEEADKTDDQYSLAIAAVALQ 1096

Mouse  1158 LAGNQDKRNEILKSLDEEAIKEDNSIHWERPQKPRKSEHNLYKPQASSVEVEMNAYVVLARLTAQ 1222
            || ...:..:::..|:..|.||::.:.|.:..:....:..::..:..|.:||:.:||:||.|...
  Fly  1097 LA-KHPQSEKVIAKLESVARKENDRMWWSKATESTGEDGRVFHWKPRSNDVEITSYVLLALLEKD 1160

Mouse  1223 PAPSPEDLTLSRSTIMWLTKQQNSNGGFSSTQDTVVALDALSKYGAVTFSRRQKTSLVTIQSTGS 1287
            ||..      :...|.||..|:|||||||||||||:.|.||:|:...|.| ...|..:...|.|.
  Fly  1161 PAEK------ALPIIKWLISQRNSNGGFSSTQDTVIGLQALTKFAYKTGS-GSGTMDIEFSSAGE 1218

Mouse  1288 FSQKFQVENSNCLLLQQVPLPDIPGDYTISVSGEGCVYAQTTLRYNMHLEKQQSAFALRVQTVPL 1352
            .....:|...|.|:||...||........:..|.|....|.:.|||:..::::.:|    :..|.
  Fly  1219 SKNTIKVNPENSLVLQTHDLPKSTRKVDFTAKGTGSAMVQLSYRYNLAEKEKKPSF----KVTPT 1279

Mouse  1353 TCNNPKGHNSFQISLEISYTGSRPA-----SNMVIADVKMLSGFIPLKPTVKKLERLEHISRTEV 1412
            ..:.|  :....:.:...|.....|     |||.:.::.:.|||:....::.|::.::.:.|.|.
  Fly  1280 VKDTP--NQLLIVDVCAEYVPLEDADKDKDSNMAVMEIALPSGFVGDSTSLGKIQAVDRVKRVET 1342

Mouse  1413 SNNN--VLLYLDQVT-NQTLAFSFIIQQDISVRNLQPAIVKVYDYYETDEVA---YAEYSSPCSS 1471
            .|::  |::|.|.:| ...........:..:|...:||.|.:||||:|:..|   |...||.|..
  Fly  1343 KNSDSTVVVYFDSLTPGDVRCLPLEASKAHAVAKQKPASVSLYDYYDTERKATEYYQVKSSLCDI 1407

Mouse  1472 GEHPAC 1477
            .|...|
  Fly  1408 CEGADC 1413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mug2XP_006505762.1 A2M_N 129..221 CDD:280081 35/93 (38%)
A2M_N_2 459..598 CDD:285005 36/153 (24%)
A2M 740..830 CDD:278630 33/95 (35%)
A2M_2 960..1266 CDD:239227 118/307 (38%)
A2M_comp 1013..1268 CDD:284982 90/256 (35%)
A2M_recep 1378..1465 CDD:284981 25/93 (27%)
Tep2NP_523506.1 A2M_N 115..209 CDD:280081 35/94 (37%)
A2M_N_2 445..576 CDD:285005 37/154 (24%)
A2M 694..782 CDD:278630 33/95 (35%)
A2M_2 909..1198 CDD:239227 118/307 (38%)
A2M_comp 961..1199 CDD:284982 90/256 (35%)
A2M_recep 1308..1398 CDD:284981 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119669153
eggNOG 1 0.900 E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D177369at33208
OrthoFinder 1 1.000 FOG0000048
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.